PREDICTED: Drosophila obscura putative odorant receptor 92a
LOCUS XM_022354774 1328 bp mRNA linear INV 14-MAY-2021
(LOC111066294), mRNA.
ACCESSION XM_022354774
VERSION XM_022354774.2
DBLINK BioProject: PRJNA728747
KEYWORDS RefSeq; corrected model.
SOURCE Drosophila obscura
ORGANISM Drosophila obscura
Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT MODEL REFSEQ: This record is predicted by automated computational
analysis. This record is derived from a genomic sequence
(NW_024542752.1) annotated using gene prediction method: Gnomon.
Also see:
Documentation of NCBI's Annotation Process
On May 14, 2021 this sequence version replaced XM_022354774.1.
##Genome-Annotation-Data-START##
Annotation Provider :: NCBI
Annotation Status :: Full annotation
Annotation Name :: Drosophila obscura Annotation
Release 101
Annotation Version :: 101
Annotation Pipeline :: NCBI eukaryotic genome annotation
pipeline
Annotation Software Version :: 8.6
Annotation Method :: Best-placed RefSeq; Gnomon
Features Annotated :: Gene; mRNA; CDS; ncRNA
##Genome-Annotation-Data-END##
##RefSeq-Attributes-START##
frameshifts :: corrected 1 indel
##RefSeq-Attributes-END##
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-699 JAECWW010000165.1 3313376-3314074
700-700 "N" 1-1
701-809 JAECWW010000165.1 3314075-3314183
810-1008 JAECWW010000165.1 3314262-3314460
1009-1328 JAECWW010000165.1 3314523-3314842
FEATURES Location/Qualifiers
source 1..1328
/organism="Drosophila obscura"
/mol_type="mRNA"
/isolate="BZ-5 IFL"
/db_xref="taxon:7282"
/chromosome="Unknown"
/sex="male"
/tissue_type="whole fly"
/dev_stage="Adult fly"
/geo_loc_name="Serbia: Babin Zub"
/collection_date="2017"
gene 1..1328
/gene="LOC111066294"
/note="The sequence of the model RefSeq transcript was
modified relative to its source genomic sequence to
represent the inferred CDS: inserted 1 base in 1 codon;
Derived by automated computational analysis using gene
prediction method: Gnomon. Supporting evidence includes
similarity to: 36 Proteins, and 98% coverage of the
annotated genomic feature by RNAseq alignments, including
3 samples with support for all annotated introns"
/db_xref="GeneID:111066294"
CDS 1..1221
/gene="LOC111066294"
/note="The sequence of the model RefSeq protein was
modified relative to its source genomic sequence to
represent the inferred CDS: inserted 1 base in 1 codon"
/codon_start=1
/product="LOW QUALITY PROTEIN: putative odorant receptor
92a"
/protein_id="XP_022210466.2"
/db_xref="GeneID:111066294"
/translation="MLWSKKKEKRELRTFEDLTRFPLAFYKTIGEDLYSERDKNLIRR
YLLRFYLVLGFLNFNAYVVGEIAYFIVHIASTTTLLEATAVAPCIGFSFMADFKQFGL
TVNRNRLVSLLDDLKALFPTTLETQRAYNVGYYQRHMNQVMTLFTILCMTYTSSFSFY
PAIKSTIKYYFLGSEIFERNYGFHIYFPYDAETDLTVYWFSYWGLAHCAYVAGVSYVC
VDLLLITTITQLTMHXSYMADTLESYDGDEHTEEENVKYLQNLVVYHSRALDLSEEVN
SIFSFTILWNFIAASLVICFAGFQITASNVEDIVLYMIFFTASLVQVFVVCYYGDEMI
SSSSRIGHAAFNQNWLPCSTKYKLILKYIIMRSQKPASIRPPTFPPISFNTFMKVISM
SYQFFALLRTTYYG"
misc_feature 232..1182
/gene="LOC111066294"
/note="7tm Odorant receptor; Region: 7tm_6; pfam02949"
/db_xref="CDD:251636"
ORIGIN
1 atgttgtgga gcaagaagaa ggagaagcgt gagctgcgca ccttcgagga tctcacccgc
61 tttccgttgg ccttctacaa gaccatcggc gaggatctgt actcggagcg ggacaagaat
121 ctcatccgac ggtatctgtt gcgcttctat ctggtgctgg gctttctcaa cttcaatgcg
181 tatgtggtgg gtgagattgc ctacttcata gtgcacattg catcgacgac aacgctgctg
241 gaggccaccg cagtggcgcc ctgcattggc ttcagtttca tggcggattt caagcagttc
301 ggcctgacgg tgaatcgcaa tcgcctcgtc agcctgctgg acgatctcaa ggcgttattt
361 cccaccacct tggagacgca gcgggcgtac aatgtgggct actatcagcg gcacatgaac
421 caagtgatga cactgttcac cattttgtgc atgacataca cctcgtcgtt cagcttctat
481 ccggccatca agtccaccat taagtattac tttttgggct cggagatatt tgagcgtaat
541 tacggctttc acatctactt tccgtacgat gcggaaacgg atctaaccgt ttattggttc
601 tcgtattggg gcttggccca ctgcgcctat gtggccggcg tgtcctatgt gtgtgtggat
661 ctgctgctca tcacgaccat cacacagctg acgatgcacn ttagctacat ggccgacaca
721 ctggagtcct acgacggcga tgagcatacc gaagaggaga atgtcaagta tctgcagaat
781 ctggtggtct atcattccag ggcattagat ctcagcgagg aggtaaacag catctttagc
841 ttcaccattt tgtggaattt cattgcggct tcgttggtga tttgctttgc tggctttcag
901 atcacagcct ccaatgtcga ggatattgtg ctctatatga tcttcttcac ggcctcgctg
961 gtgcaggtct ttgtcgtctg ctactatggc gatgaaatga tctcatcgag ttcccgcatc
1021 ggtcatgccg ccttcaatca gaattggctg ccatgcagca ctaagtacaa attgattttg
1081 aagtatatca ttatgcgcag ccagaagccc gcctccatac gaccccccac ctttccgccc
1141 atatcgttca acaccttcat gaaggtgatc agcatgtcgt atcagttctt tgcgctcctc
1201 cgcacaactt actacggcta gagggcgcta catctagccg ctcttaaggg aatattgtgc
1261 ggcaaatgaa cagatacgag ataccgagtg tatagctaaa gatacatttt ttttttctgc
1321 tagttcta