Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_022354774 1328 bp mRNA linear INV 14-MAY-2021 (LOC111066294), mRNA. ACCESSION XM_022354774 VERSION XM_022354774.2 DBLINK BioProject: PRJNA728747 KEYWORDS RefSeq; corrected model. SOURCE Drosophila obscura ORGANISM Drosophila obscura Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_024542752.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On May 14, 2021 this sequence version replaced XM_022354774.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Drosophila obscura Annotation Release 101 Annotation Version :: 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.6 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## frameshifts :: corrected 1 indel ##RefSeq-Attributes-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-699 JAECWW010000165.1 3313376-3314074 700-700 "N" 1-1 701-809 JAECWW010000165.1 3314075-3314183 810-1008 JAECWW010000165.1 3314262-3314460 1009-1328 JAECWW010000165.1 3314523-3314842 FEATURES Location/Qualifiers source 1..1328 /organism="Drosophila obscura" /mol_type="mRNA" /isolate="BZ-5 IFL" /db_xref="taxon:7282" /chromosome="Unknown" /sex="male" /tissue_type="whole fly" /dev_stage="Adult fly" /geo_loc_name="Serbia: Babin Zub" /collection_date="2017" gene 1..1328 /gene="LOC111066294" /note="The sequence of the model RefSeq transcript was modified relative to its source genomic sequence to represent the inferred CDS: inserted 1 base in 1 codon; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 36 Proteins, and 98% coverage of the annotated genomic feature by RNAseq alignments, including 3 samples with support for all annotated introns" /db_xref="GeneID:111066294" CDS 1..1221 /gene="LOC111066294" /note="The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: inserted 1 base in 1 codon" /codon_start=1 /product="LOW QUALITY PROTEIN: putative odorant receptor 92a" /protein_id="XP_022210466.2" /db_xref="GeneID:111066294" /translation="MLWSKKKEKRELRTFEDLTRFPLAFYKTIGEDLYSERDKNLIRR YLLRFYLVLGFLNFNAYVVGEIAYFIVHIASTTTLLEATAVAPCIGFSFMADFKQFGL TVNRNRLVSLLDDLKALFPTTLETQRAYNVGYYQRHMNQVMTLFTILCMTYTSSFSFY PAIKSTIKYYFLGSEIFERNYGFHIYFPYDAETDLTVYWFSYWGLAHCAYVAGVSYVC VDLLLITTITQLTMHXSYMADTLESYDGDEHTEEENVKYLQNLVVYHSRALDLSEEVN SIFSFTILWNFIAASLVICFAGFQITASNVEDIVLYMIFFTASLVQVFVVCYYGDEMI SSSSRIGHAAFNQNWLPCSTKYKLILKYIIMRSQKPASIRPPTFPPISFNTFMKVISM SYQFFALLRTTYYG" misc_feature 232..1182 /gene="LOC111066294" /note="7tm Odorant receptor; Region: 7tm_6; pfam02949" /db_xref="CDD:251636" ORIGIN 1 atgttgtgga gcaagaagaa ggagaagcgt gagctgcgca ccttcgagga tctcacccgc 61 tttccgttgg ccttctacaa gaccatcggc gaggatctgt actcggagcg ggacaagaat 121 ctcatccgac ggtatctgtt gcgcttctat ctggtgctgg gctttctcaa cttcaatgcg 181 tatgtggtgg gtgagattgc ctacttcata gtgcacattg catcgacgac aacgctgctg 241 gaggccaccg cagtggcgcc ctgcattggc ttcagtttca tggcggattt caagcagttc 301 ggcctgacgg tgaatcgcaa tcgcctcgtc agcctgctgg acgatctcaa ggcgttattt 361 cccaccacct tggagacgca gcgggcgtac aatgtgggct actatcagcg gcacatgaac 421 caagtgatga cactgttcac cattttgtgc atgacataca cctcgtcgtt cagcttctat 481 ccggccatca agtccaccat taagtattac tttttgggct cggagatatt tgagcgtaat 541 tacggctttc acatctactt tccgtacgat gcggaaacgg atctaaccgt ttattggttc 601 tcgtattggg gcttggccca ctgcgcctat gtggccggcg tgtcctatgt gtgtgtggat 661 ctgctgctca tcacgaccat cacacagctg acgatgcacn ttagctacat ggccgacaca 721 ctggagtcct acgacggcga tgagcatacc gaagaggaga atgtcaagta tctgcagaat 781 ctggtggtct atcattccag ggcattagat ctcagcgagg aggtaaacag catctttagc 841 ttcaccattt tgtggaattt cattgcggct tcgttggtga tttgctttgc tggctttcag 901 atcacagcct ccaatgtcga ggatattgtg ctctatatga tcttcttcac ggcctcgctg 961 gtgcaggtct ttgtcgtctg ctactatggc gatgaaatga tctcatcgag ttcccgcatc 1021 ggtcatgccg ccttcaatca gaattggctg ccatgcagca ctaagtacaa attgattttg 1081 aagtatatca ttatgcgcag ccagaagccc gcctccatac gaccccccac ctttccgccc 1141 atatcgttca acaccttcat gaaggtgatc agcatgtcgt atcagttctt tgcgctcctc 1201 cgcacaactt actacggcta gagggcgcta catctagccg ctcttaaggg aatattgtgc 1261 ggcaaatgaa cagatacgag ataccgagtg tatagctaaa gatacatttt ttttttctgc 1321 tagttcta