Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila obscura putative odorant receptor 92a


LOCUS       XM_022354774            1328 bp    mRNA    linear   INV 14-MAY-2021
            (LOC111066294), mRNA.
ACCESSION   XM_022354774
VERSION     XM_022354774.2
DBLINK      BioProject: PRJNA728747
KEYWORDS    RefSeq; corrected model.
SOURCE      Drosophila obscura
  ORGANISM  Drosophila obscura
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024542752.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On May 14, 2021 this sequence version replaced XM_022354774.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila obscura Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            frameshifts :: corrected 1 indel
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-699               JAECWW010000165.1  3313376-3314074
            700-700             "N"                1-1
            701-809             JAECWW010000165.1  3314075-3314183
            810-1008            JAECWW010000165.1  3314262-3314460
            1009-1328           JAECWW010000165.1  3314523-3314842
FEATURES             Location/Qualifiers
     source          1..1328
                     /organism="Drosophila obscura"
                     /mol_type="mRNA"
                     /isolate="BZ-5 IFL"
                     /db_xref="taxon:7282"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="whole fly"
                     /dev_stage="Adult fly"
                     /geo_loc_name="Serbia: Babin Zub"
                     /collection_date="2017"
     gene            1..1328
                     /gene="LOC111066294"
                     /note="The sequence of the model RefSeq transcript was
                     modified relative to its source genomic sequence to
                     represent the inferred CDS: inserted 1 base in 1 codon;
                     Derived by automated computational analysis using gene
                     prediction method: Gnomon. Supporting evidence includes
                     similarity to: 36 Proteins, and 98% coverage of the
                     annotated genomic feature by RNAseq alignments, including
                     3 samples with support for all annotated introns"
                     /db_xref="GeneID:111066294"
     CDS             1..1221
                     /gene="LOC111066294"
                     /note="The sequence of the model RefSeq protein was
                     modified relative to its source genomic sequence to
                     represent the inferred CDS: inserted 1 base in 1 codon"
                     /codon_start=1
                     /product="LOW QUALITY PROTEIN: putative odorant receptor
                     92a"
                     /protein_id="XP_022210466.2"
                     /db_xref="GeneID:111066294"
                     /translation="MLWSKKKEKRELRTFEDLTRFPLAFYKTIGEDLYSERDKNLIRR
                     YLLRFYLVLGFLNFNAYVVGEIAYFIVHIASTTTLLEATAVAPCIGFSFMADFKQFGL
                     TVNRNRLVSLLDDLKALFPTTLETQRAYNVGYYQRHMNQVMTLFTILCMTYTSSFSFY
                     PAIKSTIKYYFLGSEIFERNYGFHIYFPYDAETDLTVYWFSYWGLAHCAYVAGVSYVC
                     VDLLLITTITQLTMHXSYMADTLESYDGDEHTEEENVKYLQNLVVYHSRALDLSEEVN
                     SIFSFTILWNFIAASLVICFAGFQITASNVEDIVLYMIFFTASLVQVFVVCYYGDEMI
                     SSSSRIGHAAFNQNWLPCSTKYKLILKYIIMRSQKPASIRPPTFPPISFNTFMKVISM
                     SYQFFALLRTTYYG"
     misc_feature    232..1182
                     /gene="LOC111066294"
                     /note="7tm Odorant receptor; Region: 7tm_6; pfam02949"
                     /db_xref="CDD:251636"
ORIGIN      
        1 atgttgtgga gcaagaagaa ggagaagcgt gagctgcgca ccttcgagga tctcacccgc
       61 tttccgttgg ccttctacaa gaccatcggc gaggatctgt actcggagcg ggacaagaat
      121 ctcatccgac ggtatctgtt gcgcttctat ctggtgctgg gctttctcaa cttcaatgcg
      181 tatgtggtgg gtgagattgc ctacttcata gtgcacattg catcgacgac aacgctgctg
      241 gaggccaccg cagtggcgcc ctgcattggc ttcagtttca tggcggattt caagcagttc
      301 ggcctgacgg tgaatcgcaa tcgcctcgtc agcctgctgg acgatctcaa ggcgttattt
      361 cccaccacct tggagacgca gcgggcgtac aatgtgggct actatcagcg gcacatgaac
      421 caagtgatga cactgttcac cattttgtgc atgacataca cctcgtcgtt cagcttctat
      481 ccggccatca agtccaccat taagtattac tttttgggct cggagatatt tgagcgtaat
      541 tacggctttc acatctactt tccgtacgat gcggaaacgg atctaaccgt ttattggttc
      601 tcgtattggg gcttggccca ctgcgcctat gtggccggcg tgtcctatgt gtgtgtggat
      661 ctgctgctca tcacgaccat cacacagctg acgatgcacn ttagctacat ggccgacaca
      721 ctggagtcct acgacggcga tgagcatacc gaagaggaga atgtcaagta tctgcagaat
      781 ctggtggtct atcattccag ggcattagat ctcagcgagg aggtaaacag catctttagc
      841 ttcaccattt tgtggaattt cattgcggct tcgttggtga tttgctttgc tggctttcag
      901 atcacagcct ccaatgtcga ggatattgtg ctctatatga tcttcttcac ggcctcgctg
      961 gtgcaggtct ttgtcgtctg ctactatggc gatgaaatga tctcatcgag ttcccgcatc
     1021 ggtcatgccg ccttcaatca gaattggctg ccatgcagca ctaagtacaa attgattttg
     1081 aagtatatca ttatgcgcag ccagaagccc gcctccatac gaccccccac ctttccgccc
     1141 atatcgttca acaccttcat gaaggtgatc agcatgtcgt atcagttctt tgcgctcctc
     1201 cgcacaactt actacggcta gagggcgcta catctagccg ctcttaaggg aatattgtgc
     1261 ggcaaatgaa cagatacgag ataccgagtg tatagctaaa gatacatttt ttttttctgc
     1321 tagttcta