PREDICTED: Drosophila obscura protein BRAWNIN (LOC111066293), mRNA.

LOCUS       XM_022354773             261 bp    mRNA    linear   INV 14-MAY-2021
ACCESSION   XM_022354773
VERSION     XM_022354773.2
DBLINK      BioProject: PRJNA728747
KEYWORDS    RefSeq.
SOURCE      Drosophila obscura
  ORGANISM  Drosophila obscura
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024542752.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On May 14, 2021 this sequence version replaced XM_022354773.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila obscura Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..261
                     /organism="Drosophila obscura"
                     /mol_type="mRNA"
                     /isolate="BZ-5 IFL"
                     /db_xref="taxon:7282"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="whole fly"
                     /dev_stage="Adult fly"
                     /geo_loc_name="Serbia: Babin Zub"
                     /collection_date="2017"
     gene            1..261
                     /gene="LOC111066293"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 2 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments"
                     /db_xref="GeneID:111066293"
     CDS             1..174
                     /gene="LOC111066293"
                     /codon_start=1
                     /product="protein BRAWNIN"
                     /protein_id="XP_022210465.1"
                     /db_xref="GeneID:111066293"
                     /translation="MPAGVSWAQYSKFLASAMLAMMAGSQAVHLYYKPLEDLPVYIER
                     EQKPPANQAKAAD"
     misc_feature    1..138
                     /gene="LOC111066293"
                     /note="Domain of unknown function (DUF4516); Region:
                     DUF4516; pfam14990"
                     /db_xref="CDD:464425"
ORIGIN      
        1 atgcccgctg gcgtgtcgtg ggctcaatac agcaagttcc tggccagcgc aatgctggcc
       61 atgatggccg gatcccaggc ggtgcatctg tactacaagc cgctcgaaga tctgcccgtc
      121 tacatagagc gcgagcagaa gccgccggcc aatcaggcaa aggctgcgga ctaaccaccc
      181 ccacccataa actacaacta tattctgtaa gaactattgt attgactaat gctaattaaa
      241 tttcacttgt ttgacagaca a