PREDICTED: Drosophila obscura small integral membrane protein 4

LOCUS       XM_022354771             487 bp    mRNA    linear   INV 14-MAY-2021
            (LOC111066292), mRNA.
ACCESSION   XM_022354771
VERSION     XM_022354771.2
DBLINK      BioProject: PRJNA728747
KEYWORDS    RefSeq.
SOURCE      Drosophila obscura
  ORGANISM  Drosophila obscura
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024542752.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On May 14, 2021 this sequence version replaced XM_022354771.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila obscura Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..487
                     /organism="Drosophila obscura"
                     /mol_type="mRNA"
                     /isolate="BZ-5 IFL"
                     /db_xref="taxon:7282"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="whole fly"
                     /dev_stage="Adult fly"
                     /geo_loc_name="Serbia: Babin Zub"
                     /collection_date="2017"
     gene            1..487
                     /gene="LOC111066292"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 4 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 17 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:111066292"
     CDS             238..480
                     /gene="LOC111066292"
                     /codon_start=1
                     /product="small integral membrane protein 4"
                     /protein_id="XP_022210463.2"
                     /db_xref="GeneID:111066292"
                     /translation="MNLYSGSVRRLLDSWPGKRRFGIYRFLPLFFVLGAALEFSMINW
                     TVGETNFYSTFKRRQAKNYVEEQQHHQQQQQQQQQQ"
     misc_feature    247..435
                     /gene="LOC111066292"
                     /note="Uncharacterized protein family UPF0640; Region:
                     UPF0640; pfam15114"
                     /db_xref="CDD:464511"
ORIGIN      
        1 taccagaccg cgttaaccaa ccagctgtta tagcgacggt acaaaaagca cagaactttt
       61 ttaaaaaatt taaaaattcc cagctaactt gctgagtttc cgttagctgc ttcgagggca
      121 gacagagttt gatggatgct tgaatccgca gcggccaaag cagacaaacg cccgcgcaca
      181 ttaaccgcca gcagtcagca cgaaattata taattccccc tcgctgcggc cagacacatg
      241 aatctatata gcggctccgt gcgacgtctg ctcgacagtt ggcccggcaa gcgacgcttt
      301 ggcatctacc gcttcctgcc gctcttcttt gtgctgggcg ccgcccttga gttctccatg
      361 atcaactgga cggtgggcga aacgaatttc tatagtactt ttaagcgtcg ccaggccaag
      421 aattacgtgg aggagcagca gcatcatcag cagcaacagc agcagcagca gcagcagtag
      481 tcgcata