Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila obscura AP-3 complex subunit mu-2


LOCUS       XM_022354770            1503 bp    mRNA    linear   INV 14-MAY-2021
            (LOC111066291), mRNA.
ACCESSION   XM_022354770
VERSION     XM_022354770.2
DBLINK      BioProject: PRJNA728747
KEYWORDS    RefSeq.
SOURCE      Drosophila obscura
  ORGANISM  Drosophila obscura
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024542752.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On May 14, 2021 this sequence version replaced XM_022354770.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila obscura Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1503
                     /organism="Drosophila obscura"
                     /mol_type="mRNA"
                     /isolate="BZ-5 IFL"
                     /db_xref="taxon:7282"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="whole fly"
                     /dev_stage="Adult fly"
                     /geo_loc_name="Serbia: Babin Zub"
                     /collection_date="2017"
     gene            1..1503
                     /gene="LOC111066291"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 54 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 17 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:111066291"
     CDS             78..1325
                     /gene="LOC111066291"
                     /codon_start=1
                     /product="AP-3 complex subunit mu-2"
                     /protein_id="XP_022210462.1"
                     /db_xref="GeneID:111066291"
                     /translation="MIHSLFIVNSGGEVFLEKHWRSVVSRSVCEYFLDAQRAAPYDVP
                     PVIATPHYYLITVQREAVSLVAACKQEVPPLFVIEFLHRVVDTFQDYFGDCSETVIKD
                     NYVVVYELLDEMLDNGFPLATESNILKELIKPPNILRTIANTVTGKSNVSTILPSGQL
                     SAIPWRRSGVRYTNNEAYFDVIEEVDAIIDKSGSTVFAEIQGHIDCCIKLSGMPDLTL
                     SFMNPRLFDDVSFHPCVRFKRWEAERLLSFIPPDGNFRLMSYHISSQSVVAIPIYIRH
                     NFSIKTGEQGRLDLTIGPRNTLGRTVDKVRLELTMPRCVLNCLLTPNQGKYTFDSVSK
                     TLSWDVGRIDVSKLPNIRGSVSITPGTTNIDANPSVNVQFQISQLAVSGLKVNRLDMY
                     GEKYKPFKGVKYLTKAGKFQVRM"
     misc_feature    84..494
                     /gene="LOC111066291"
                     /note="AP-3 complex subunit mu N-terminal domain; Region:
                     AP3_Mu_N; cd14837"
                     /db_xref="CDD:341441"
     misc_feature    order(129..131,138..140,207..212,234..236,240..242,
                     246..248,282..290,294..302,309..311,321..323,399..404,
                     411..416,420..428,432..443,468..470,474..479)
                     /gene="LOC111066291"
                     /note="putative AP-3 beta interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:341441"
     misc_feature    564..1319
                     /gene="LOC111066291"
                     /note="C-terminal domain of adaptor protein (AP) complexes
                     medium mu subunits and its homologs (MHD); Region:
                     AP_MHD_Cterm; cl10970"
                     /db_xref="CDD:472082"
ORIGIN      
        1 tagggtattg tgtgcgcttg ccaacactgc ccgaaattgc gaatcaagaa aaaattgtaa
       61 acaacttggg ccgaaatatg atacacagtt tgtttatcgt taacagcggg ggcgaggtgt
      121 tcctagagaa gcactggcgg tctgtcgtct cgcgatccgt ttgcgaatat ttcctcgatg
      181 cgcagcgcgc tgcaccatat gatgtgccgc cggtgatagc cacgccccac tactacctca
      241 tcacggtgca gcgggaggcg gtctccctgg tggccgcctg caagcaggag gtgccgccac
      301 tctttgtgat cgaattcctg caccgtgtgg tggacacatt ccaggactac tttggcgact
      361 gctcggagac ggtgatcaag gacaactatg tggtcgtcta tgagctgctc gacgagatgc
      421 tggacaacgg ctttcccctg gccacggaga gcaacatcct gaaggagctg atcaagccgc
      481 cgaatatact ccgcaccatt gccaacaccg tcaccggcaa gagcaatgtc agcaccatcc
      541 tgccctcggg ccagctgtcg gccataccct ggcgacggag cggtgtgcgg tatacgaaca
      601 acgaggccta cttcgatgtc atcgaggagg tggacgccat cattgataag tccggatcca
      661 ctgtctttgc cgaaatccag ggacacatcg attgctgcat caagctgtcg ggcatgccgg
      721 atctgacgtt gtcctttatg aatccacgcc tcttcgacga cgtctcgttc catccgtgcg
      781 tgcggttcaa gcgctgggag gccgagcgcc tgctctcctt tataccgccc gacggaaatt
      841 tccgtctgat gtcctatcac attagttcgc agtcggtggt ggccataccc atttacatac
      901 ggcacaactt ttcgattaag acgggcgaac agggccgcct ggatctgacc attgggccac
      961 gcaacacact gggacgcacc gtggacaaag tgcggctgga gctaacgatg ccccggtgcg
     1021 tgctcaattg cctgctgacg ccgaatcagg gcaaatatac gttcgattcg gtcagcaaga
     1081 cgctgtcctg ggatgtgggc cgcatcgatg tctccaagct gcccaatata cgtggatcgg
     1141 tgtccatcac accgggcacg accaacatcg atgccaatcc atcggtgaat gtgcaattcc
     1201 agatatcgca gctggccgtc tccggtctga aggtgaatcg cctggacatg tacggtgaga
     1261 agtacaagcc cttcaagggc gtcaaatatc tgacaaaggc gggcaagttt caagtgcgaa
     1321 tgtaaacgaa tggcgtccat cctaaccggc caggcaaccg caaaccagcc ttcattaagt
     1381 gtacatctta agcgtattcc aaataccttg ttttctgtca ccccgctatc tctaactatc
     1441 catctatcca tccattcctt gctctgtcca ttaaagaaga gccacagccc gatggcttca
     1501 aat