Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_022354770 1503 bp mRNA linear INV 14-MAY-2021 (LOC111066291), mRNA. ACCESSION XM_022354770 VERSION XM_022354770.2 DBLINK BioProject: PRJNA728747 KEYWORDS RefSeq. SOURCE Drosophila obscura ORGANISM Drosophila obscura Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_024542752.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On May 14, 2021 this sequence version replaced XM_022354770.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Drosophila obscura Annotation Release 101 Annotation Version :: 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.6 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1503 /organism="Drosophila obscura" /mol_type="mRNA" /isolate="BZ-5 IFL" /db_xref="taxon:7282" /chromosome="Unknown" /sex="male" /tissue_type="whole fly" /dev_stage="Adult fly" /geo_loc_name="Serbia: Babin Zub" /collection_date="2017" gene 1..1503 /gene="LOC111066291" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 54 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 17 samples with support for all annotated introns" /db_xref="GeneID:111066291" CDS 78..1325 /gene="LOC111066291" /codon_start=1 /product="AP-3 complex subunit mu-2" /protein_id="XP_022210462.1" /db_xref="GeneID:111066291" /translation="MIHSLFIVNSGGEVFLEKHWRSVVSRSVCEYFLDAQRAAPYDVP PVIATPHYYLITVQREAVSLVAACKQEVPPLFVIEFLHRVVDTFQDYFGDCSETVIKD NYVVVYELLDEMLDNGFPLATESNILKELIKPPNILRTIANTVTGKSNVSTILPSGQL SAIPWRRSGVRYTNNEAYFDVIEEVDAIIDKSGSTVFAEIQGHIDCCIKLSGMPDLTL SFMNPRLFDDVSFHPCVRFKRWEAERLLSFIPPDGNFRLMSYHISSQSVVAIPIYIRH NFSIKTGEQGRLDLTIGPRNTLGRTVDKVRLELTMPRCVLNCLLTPNQGKYTFDSVSK TLSWDVGRIDVSKLPNIRGSVSITPGTTNIDANPSVNVQFQISQLAVSGLKVNRLDMY GEKYKPFKGVKYLTKAGKFQVRM" misc_feature 84..494 /gene="LOC111066291" /note="AP-3 complex subunit mu N-terminal domain; Region: AP3_Mu_N; cd14837" /db_xref="CDD:341441" misc_feature order(129..131,138..140,207..212,234..236,240..242, 246..248,282..290,294..302,309..311,321..323,399..404, 411..416,420..428,432..443,468..470,474..479) /gene="LOC111066291" /note="putative AP-3 beta interface [polypeptide binding]; other site" /db_xref="CDD:341441" misc_feature 564..1319 /gene="LOC111066291" /note="C-terminal domain of adaptor protein (AP) complexes medium mu subunits and its homologs (MHD); Region: AP_MHD_Cterm; cl10970" /db_xref="CDD:472082" ORIGIN 1 tagggtattg tgtgcgcttg ccaacactgc ccgaaattgc gaatcaagaa aaaattgtaa 61 acaacttggg ccgaaatatg atacacagtt tgtttatcgt taacagcggg ggcgaggtgt 121 tcctagagaa gcactggcgg tctgtcgtct cgcgatccgt ttgcgaatat ttcctcgatg 181 cgcagcgcgc tgcaccatat gatgtgccgc cggtgatagc cacgccccac tactacctca 241 tcacggtgca gcgggaggcg gtctccctgg tggccgcctg caagcaggag gtgccgccac 301 tctttgtgat cgaattcctg caccgtgtgg tggacacatt ccaggactac tttggcgact 361 gctcggagac ggtgatcaag gacaactatg tggtcgtcta tgagctgctc gacgagatgc 421 tggacaacgg ctttcccctg gccacggaga gcaacatcct gaaggagctg atcaagccgc 481 cgaatatact ccgcaccatt gccaacaccg tcaccggcaa gagcaatgtc agcaccatcc 541 tgccctcggg ccagctgtcg gccataccct ggcgacggag cggtgtgcgg tatacgaaca 601 acgaggccta cttcgatgtc atcgaggagg tggacgccat cattgataag tccggatcca 661 ctgtctttgc cgaaatccag ggacacatcg attgctgcat caagctgtcg ggcatgccgg 721 atctgacgtt gtcctttatg aatccacgcc tcttcgacga cgtctcgttc catccgtgcg 781 tgcggttcaa gcgctgggag gccgagcgcc tgctctcctt tataccgccc gacggaaatt 841 tccgtctgat gtcctatcac attagttcgc agtcggtggt ggccataccc atttacatac 901 ggcacaactt ttcgattaag acgggcgaac agggccgcct ggatctgacc attgggccac 961 gcaacacact gggacgcacc gtggacaaag tgcggctgga gctaacgatg ccccggtgcg 1021 tgctcaattg cctgctgacg ccgaatcagg gcaaatatac gttcgattcg gtcagcaaga 1081 cgctgtcctg ggatgtgggc cgcatcgatg tctccaagct gcccaatata cgtggatcgg 1141 tgtccatcac accgggcacg accaacatcg atgccaatcc atcggtgaat gtgcaattcc 1201 agatatcgca gctggccgtc tccggtctga aggtgaatcg cctggacatg tacggtgaga 1261 agtacaagcc cttcaagggc gtcaaatatc tgacaaaggc gggcaagttt caagtgcgaa 1321 tgtaaacgaa tggcgtccat cctaaccggc caggcaaccg caaaccagcc ttcattaagt 1381 gtacatctta agcgtattcc aaataccttg ttttctgtca ccccgctatc tctaactatc 1441 catctatcca tccattcctt gctctgtcca ttaaagaaga gccacagccc gatggcttca 1501 aat