PREDICTED: Drosophila obscura ribokinase (LOC111066254), mRNA.
LOCUS XM_022354709 1214 bp mRNA linear INV 14-MAY-2021
ACCESSION XM_022354709
VERSION XM_022354709.2
DBLINK BioProject: PRJNA728747
KEYWORDS RefSeq.
SOURCE Drosophila obscura
ORGANISM Drosophila obscura
Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT MODEL REFSEQ: This record is predicted by automated computational
analysis. This record is derived from a genomic sequence
(NW_024542752.1) annotated using gene prediction method: Gnomon.
Also see:
Documentation of NCBI's Annotation Process
On May 14, 2021 this sequence version replaced XM_022354709.1.
##Genome-Annotation-Data-START##
Annotation Provider :: NCBI
Annotation Status :: Full annotation
Annotation Name :: Drosophila obscura Annotation
Release 101
Annotation Version :: 101
Annotation Pipeline :: NCBI eukaryotic genome annotation
pipeline
Annotation Software Version :: 8.6
Annotation Method :: Best-placed RefSeq; Gnomon
Features Annotated :: Gene; mRNA; CDS; ncRNA
##Genome-Annotation-Data-END##
FEATURES Location/Qualifiers
source 1..1214
/organism="Drosophila obscura"
/mol_type="mRNA"
/isolate="BZ-5 IFL"
/db_xref="taxon:7282"
/chromosome="Unknown"
/sex="male"
/tissue_type="whole fly"
/dev_stage="Adult fly"
/geo_loc_name="Serbia: Babin Zub"
/collection_date="2017"
gene 1..1214
/gene="LOC111066254"
/note="Derived by automated computational analysis using
gene prediction method: Gnomon. Supporting evidence
includes similarity to: 6 Proteins, and 100% coverage of
the annotated genomic feature by RNAseq alignments,
including 17 samples with support for all annotated
introns"
/db_xref="GeneID:111066254"
CDS 71..1129
/gene="LOC111066254"
/codon_start=1
/product="ribokinase"
/protein_id="XP_022210401.1"
/db_xref="GeneID:111066254"
/translation="MELAKLLIRPLLRPISIVHWDRKFNRLVINQRLAAVCKKTQHGT
EGSWKMSEETDVLVFGSAIIDFICYTPRLPKAGETLHGHKFQTGYGGKGANQCVAAAR
LGSSTALVAKLGDDSFGSDYLRQLREENVNVSHVHQLTGHTTGIAQIAVSDGGENNII
IVVGANNQLSPDDVFIAKALFSGAKVLVCQLETPVAATLQALRCFKGISIVNAAPAME
QTPPELLQLANIFCVNESEAAIMTGVSSVSSIEQANAACKRLIEMGANTVILTLGPLG
AVWGAKDSTGKFQHVPAPQVQNVVDTTGAGDAFIGALAHNLARFPERALDAHIAAACA
VASQSVQLPGTQSSFPRA"
misc_feature 233..1120
/gene="LOC111066254"
/note="Ribokinase catalyses the phosphorylation of ribose
to ribose-5-phosphate using ATP. This reaction is the
first step in the ribose metabolism. It traps ribose
within the cell after uptake and also prepares the sugar
for use in the synthesis of nucleotides...; Region:
ribokinase; cd01174"
/db_xref="CDD:238579"
misc_feature order(257..259,263..265,338..346,353..355,509..511,
515..517,545..547,551..553,644..646,977..982,989..991,
1103..1105)
/gene="LOC111066254"
/note="substrate binding site [chemical binding]; other
site"
/db_xref="CDD:238579"
misc_feature order(266..268,272..274,287..307,344..346,506..508,
512..520,536..559,713..715)
/gene="LOC111066254"
/note="dimer interface [polypeptide binding]; other site"
/db_xref="CDD:238579"
misc_feature order(770..772,881..889,896..898,944..946,965..967,
974..976,983..988,995..997,1067..1069,1076..1081,
1088..1090)
/gene="LOC111066254"
/note="ATP binding site [chemical binding]; other site"
/db_xref="CDD:238579"
ORIGIN
1 gccatttaaa tgaatttctc tgcctttctc aaatactccc agccgcctct ctccgttccg
61 tcgaccgtga atggaattgg ccaagttact gataaggccc ctgttgcgcc cgataagcat
121 agtacactgg gatcgtaaat tcaatcgttt agttataaat cagcgcctcg ctgcagtttg
181 caaaaaaaca caacacggaa cggaaggcag ctggaaaatg agtgaggaaa ctgacgttct
241 ggtcttcggt tcggccatta tagattttat ctgctacacg ccccgcctgc ccaaggccgg
301 ggagacgctt cacggacaca aattccagac cggctacggc ggcaagggcg ccaatcagtg
361 tgtggcagcc gccaggctgg gctccagcac ggccttggtg gccaaactgg gcgacgatag
421 ctttggcagc gactacctcc gccagctgcg ggaggagaac gtcaatgtca gccacgtgca
481 tcagctgacg ggccacacca caggcattgc ccagatcgcc gtctccgacg gtggcgagaa
541 caacatcatc attgttgtgg gtgccaataa ccagctgagt cccgacgacg tcttcatcgc
601 caaggcgctg tttagcgggg ccaaagtact cgtgtgccag ctggagacgc ccgtcgcagc
661 cacgctccag gccctgcgct gcttcaaggg tatatccatt gtgaacgccg ctccggccat
721 ggaacagacg ccgccagagc tgctgcagct ggccaacatc ttctgcgtga acgagagcga
781 ggcggccatt atgacgggag tgtccagcgt gagcagcata gagcaagcca acgccgcctg
841 caagcggctc attgagatgg gtgccaacac ggtgattctc acactgggcc cactgggagc
901 tgtgtgggga gccaaggact cgaccggcaa gttccagcat gtgcccgctc cccaggtcca
961 gaatgtggtg gacactacgg gggcgggaga cgccttcatc ggtgcgctgg cccacaacct
1021 ggcccgcttc ccagagcgag ccctcgatgc acacattgcg gccgcttgtg cggtggcctc
1081 gcagtctgtc cagctgccag ggacccagtc gagtttcccc cgcgcctagc gtgtggccac
1141 aggaggccag tagctgtagt tcccgtgtac ttacatacgt ccaataaatc tccaccttga
1201 aaaccaatct ctgg