Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila obscura ribokinase (LOC111066254), mRNA.


LOCUS       XM_022354709            1214 bp    mRNA    linear   INV 14-MAY-2021
ACCESSION   XM_022354709
VERSION     XM_022354709.2
DBLINK      BioProject: PRJNA728747
KEYWORDS    RefSeq.
SOURCE      Drosophila obscura
  ORGANISM  Drosophila obscura
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024542752.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On May 14, 2021 this sequence version replaced XM_022354709.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila obscura Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1214
                     /organism="Drosophila obscura"
                     /mol_type="mRNA"
                     /isolate="BZ-5 IFL"
                     /db_xref="taxon:7282"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="whole fly"
                     /dev_stage="Adult fly"
                     /geo_loc_name="Serbia: Babin Zub"
                     /collection_date="2017"
     gene            1..1214
                     /gene="LOC111066254"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 6 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 17 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:111066254"
     CDS             71..1129
                     /gene="LOC111066254"
                     /codon_start=1
                     /product="ribokinase"
                     /protein_id="XP_022210401.1"
                     /db_xref="GeneID:111066254"
                     /translation="MELAKLLIRPLLRPISIVHWDRKFNRLVINQRLAAVCKKTQHGT
                     EGSWKMSEETDVLVFGSAIIDFICYTPRLPKAGETLHGHKFQTGYGGKGANQCVAAAR
                     LGSSTALVAKLGDDSFGSDYLRQLREENVNVSHVHQLTGHTTGIAQIAVSDGGENNII
                     IVVGANNQLSPDDVFIAKALFSGAKVLVCQLETPVAATLQALRCFKGISIVNAAPAME
                     QTPPELLQLANIFCVNESEAAIMTGVSSVSSIEQANAACKRLIEMGANTVILTLGPLG
                     AVWGAKDSTGKFQHVPAPQVQNVVDTTGAGDAFIGALAHNLARFPERALDAHIAAACA
                     VASQSVQLPGTQSSFPRA"
     misc_feature    233..1120
                     /gene="LOC111066254"
                     /note="Ribokinase catalyses the phosphorylation of ribose
                     to ribose-5-phosphate using ATP. This reaction is the
                     first step in the ribose metabolism. It traps ribose
                     within the cell after uptake and also prepares the sugar
                     for use in the synthesis of nucleotides...; Region:
                     ribokinase; cd01174"
                     /db_xref="CDD:238579"
     misc_feature    order(257..259,263..265,338..346,353..355,509..511,
                     515..517,545..547,551..553,644..646,977..982,989..991,
                     1103..1105)
                     /gene="LOC111066254"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238579"
     misc_feature    order(266..268,272..274,287..307,344..346,506..508,
                     512..520,536..559,713..715)
                     /gene="LOC111066254"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238579"
     misc_feature    order(770..772,881..889,896..898,944..946,965..967,
                     974..976,983..988,995..997,1067..1069,1076..1081,
                     1088..1090)
                     /gene="LOC111066254"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238579"
ORIGIN      
        1 gccatttaaa tgaatttctc tgcctttctc aaatactccc agccgcctct ctccgttccg
       61 tcgaccgtga atggaattgg ccaagttact gataaggccc ctgttgcgcc cgataagcat
      121 agtacactgg gatcgtaaat tcaatcgttt agttataaat cagcgcctcg ctgcagtttg
      181 caaaaaaaca caacacggaa cggaaggcag ctggaaaatg agtgaggaaa ctgacgttct
      241 ggtcttcggt tcggccatta tagattttat ctgctacacg ccccgcctgc ccaaggccgg
      301 ggagacgctt cacggacaca aattccagac cggctacggc ggcaagggcg ccaatcagtg
      361 tgtggcagcc gccaggctgg gctccagcac ggccttggtg gccaaactgg gcgacgatag
      421 ctttggcagc gactacctcc gccagctgcg ggaggagaac gtcaatgtca gccacgtgca
      481 tcagctgacg ggccacacca caggcattgc ccagatcgcc gtctccgacg gtggcgagaa
      541 caacatcatc attgttgtgg gtgccaataa ccagctgagt cccgacgacg tcttcatcgc
      601 caaggcgctg tttagcgggg ccaaagtact cgtgtgccag ctggagacgc ccgtcgcagc
      661 cacgctccag gccctgcgct gcttcaaggg tatatccatt gtgaacgccg ctccggccat
      721 ggaacagacg ccgccagagc tgctgcagct ggccaacatc ttctgcgtga acgagagcga
      781 ggcggccatt atgacgggag tgtccagcgt gagcagcata gagcaagcca acgccgcctg
      841 caagcggctc attgagatgg gtgccaacac ggtgattctc acactgggcc cactgggagc
      901 tgtgtgggga gccaaggact cgaccggcaa gttccagcat gtgcccgctc cccaggtcca
      961 gaatgtggtg gacactacgg gggcgggaga cgccttcatc ggtgcgctgg cccacaacct
     1021 ggcccgcttc ccagagcgag ccctcgatgc acacattgcg gccgcttgtg cggtggcctc
     1081 gcagtctgtc cagctgccag ggacccagtc gagtttcccc cgcgcctagc gtgtggccac
     1141 aggaggccag tagctgtagt tcccgtgtac ttacatacgt ccaataaatc tccaccttga
     1201 aaaccaatct ctgg