Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_022354709 1214 bp mRNA linear INV 14-MAY-2021 ACCESSION XM_022354709 VERSION XM_022354709.2 DBLINK BioProject: PRJNA728747 KEYWORDS RefSeq. SOURCE Drosophila obscura ORGANISM Drosophila obscura Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_024542752.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On May 14, 2021 this sequence version replaced XM_022354709.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Drosophila obscura Annotation Release 101 Annotation Version :: 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.6 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1214 /organism="Drosophila obscura" /mol_type="mRNA" /isolate="BZ-5 IFL" /db_xref="taxon:7282" /chromosome="Unknown" /sex="male" /tissue_type="whole fly" /dev_stage="Adult fly" /geo_loc_name="Serbia: Babin Zub" /collection_date="2017" gene 1..1214 /gene="LOC111066254" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 6 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 17 samples with support for all annotated introns" /db_xref="GeneID:111066254" CDS 71..1129 /gene="LOC111066254" /codon_start=1 /product="ribokinase" /protein_id="XP_022210401.1" /db_xref="GeneID:111066254" /translation="MELAKLLIRPLLRPISIVHWDRKFNRLVINQRLAAVCKKTQHGT EGSWKMSEETDVLVFGSAIIDFICYTPRLPKAGETLHGHKFQTGYGGKGANQCVAAAR LGSSTALVAKLGDDSFGSDYLRQLREENVNVSHVHQLTGHTTGIAQIAVSDGGENNII IVVGANNQLSPDDVFIAKALFSGAKVLVCQLETPVAATLQALRCFKGISIVNAAPAME QTPPELLQLANIFCVNESEAAIMTGVSSVSSIEQANAACKRLIEMGANTVILTLGPLG AVWGAKDSTGKFQHVPAPQVQNVVDTTGAGDAFIGALAHNLARFPERALDAHIAAACA VASQSVQLPGTQSSFPRA" misc_feature 233..1120 /gene="LOC111066254" /note="Ribokinase catalyses the phosphorylation of ribose to ribose-5-phosphate using ATP. This reaction is the first step in the ribose metabolism. It traps ribose within the cell after uptake and also prepares the sugar for use in the synthesis of nucleotides...; Region: ribokinase; cd01174" /db_xref="CDD:238579" misc_feature order(257..259,263..265,338..346,353..355,509..511, 515..517,545..547,551..553,644..646,977..982,989..991, 1103..1105) /gene="LOC111066254" /note="substrate binding site [chemical binding]; other site" /db_xref="CDD:238579" misc_feature order(266..268,272..274,287..307,344..346,506..508, 512..520,536..559,713..715) /gene="LOC111066254" /note="dimer interface [polypeptide binding]; other site" /db_xref="CDD:238579" misc_feature order(770..772,881..889,896..898,944..946,965..967, 974..976,983..988,995..997,1067..1069,1076..1081, 1088..1090) /gene="LOC111066254" /note="ATP binding site [chemical binding]; other site" /db_xref="CDD:238579" ORIGIN 1 gccatttaaa tgaatttctc tgcctttctc aaatactccc agccgcctct ctccgttccg 61 tcgaccgtga atggaattgg ccaagttact gataaggccc ctgttgcgcc cgataagcat 121 agtacactgg gatcgtaaat tcaatcgttt agttataaat cagcgcctcg ctgcagtttg 181 caaaaaaaca caacacggaa cggaaggcag ctggaaaatg agtgaggaaa ctgacgttct 241 ggtcttcggt tcggccatta tagattttat ctgctacacg ccccgcctgc ccaaggccgg 301 ggagacgctt cacggacaca aattccagac cggctacggc ggcaagggcg ccaatcagtg 361 tgtggcagcc gccaggctgg gctccagcac ggccttggtg gccaaactgg gcgacgatag 421 ctttggcagc gactacctcc gccagctgcg ggaggagaac gtcaatgtca gccacgtgca 481 tcagctgacg ggccacacca caggcattgc ccagatcgcc gtctccgacg gtggcgagaa 541 caacatcatc attgttgtgg gtgccaataa ccagctgagt cccgacgacg tcttcatcgc 601 caaggcgctg tttagcgggg ccaaagtact cgtgtgccag ctggagacgc ccgtcgcagc 661 cacgctccag gccctgcgct gcttcaaggg tatatccatt gtgaacgccg ctccggccat 721 ggaacagacg ccgccagagc tgctgcagct ggccaacatc ttctgcgtga acgagagcga 781 ggcggccatt atgacgggag tgtccagcgt gagcagcata gagcaagcca acgccgcctg 841 caagcggctc attgagatgg gtgccaacac ggtgattctc acactgggcc cactgggagc 901 tgtgtgggga gccaaggact cgaccggcaa gttccagcat gtgcccgctc cccaggtcca 961 gaatgtggtg gacactacgg gggcgggaga cgccttcatc ggtgcgctgg cccacaacct 1021 ggcccgcttc ccagagcgag ccctcgatgc acacattgcg gccgcttgtg cggtggcctc 1081 gcagtctgtc cagctgccag ggacccagtc gagtttcccc cgcgcctagc gtgtggccac 1141 aggaggccag tagctgtagt tcccgtgtac ttacatacgt ccaataaatc tccaccttga 1201 aaaccaatct ctgg