Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_022354691 1837 bp mRNA linear INV 14-MAY-2021 protein 58 (LOC111066243), mRNA. ACCESSION XM_022354691 VERSION XM_022354691.2 DBLINK BioProject: PRJNA728747 KEYWORDS RefSeq. SOURCE Drosophila obscura ORGANISM Drosophila obscura Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_024542752.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On May 14, 2021 this sequence version replaced XM_022354691.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Drosophila obscura Annotation Release 101 Annotation Version :: 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.6 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1837 /organism="Drosophila obscura" /mol_type="mRNA" /isolate="BZ-5 IFL" /db_xref="taxon:7282" /chromosome="Unknown" /sex="male" /tissue_type="whole fly" /dev_stage="Adult fly" /geo_loc_name="Serbia: Babin Zub" /collection_date="2017" gene 1..1837 /gene="LOC111066243" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 17 samples with support for all annotated introns" /db_xref="GeneID:111066243" CDS 369..1484 /gene="LOC111066243" /codon_start=1 /product="leucine-rich repeat-containing protein 58" /protein_id="XP_022210383.1" /db_xref="GeneID:111066243" /translation="MEVYTSDSSDTDSRDQKTIDFGRMSLDSVTLEDHLTSPHKALLK SSGDIETMLLNHNRLVSLPRVLQQFANLKVLDLSSNAITQLPDAICQLPLVTLIAKNN LLTNCSLPKSLLAKQAAGGGYGHGHSTLKELNLSGNQLTHFPEQVTELRHLKYLYVGG NKITGISKDIWKLQSLHVLSLGGNLISEVPDAVGSLSQLQALVLCDNLIENLPMSIAR LKNLKSLLLHKNRLRHLPKDIVALKNLTELSLRDNPLVVRFVQDMALKPPTLLELAGR IVKASGQRPGPYDIPRTLAEYLNSANCCVNPNCKGVFFDNRVEHIKFVDFCGKYRVPL LQYLCSSKCIEHEEPARGSSASSSANSGFMMRKVLLG" misc_feature 513..581 /gene="LOC111066243" /note="leucine-rich repeat [structural motif]; Region: leucine-rich repeat" /db_xref="CDD:275380" misc_feature <546..>1133 /gene="LOC111066243" /note="Leucine-rich repeat (LRR) protein [Transcription]; Region: LRR; COG4886" /db_xref="CDD:443914" misc_feature 582..644 /gene="LOC111066243" /note="leucine-rich repeat [structural motif]; Region: leucine-rich repeat" /db_xref="CDD:275380" misc_feature 648..755 /gene="LOC111066243" /note="leucine-rich repeat [structural motif]; Region: leucine-rich repeat" /db_xref="CDD:275380" misc_feature 756..824 /gene="LOC111066243" /note="leucine-rich repeat [structural motif]; Region: leucine-rich repeat" /db_xref="CDD:275380" misc_feature 825..893 /gene="LOC111066243" /note="leucine-rich repeat [structural motif]; Region: leucine-rich repeat" /db_xref="CDD:275380" misc_feature 894..962 /gene="LOC111066243" /note="leucine-rich repeat [structural motif]; Region: leucine-rich repeat" /db_xref="CDD:275380" misc_feature 963..1031 /gene="LOC111066243" /note="leucine-rich repeat [structural motif]; Region: leucine-rich repeat" /db_xref="CDD:275380" misc_feature 1032..1100 /gene="LOC111066243" /note="leucine-rich repeat [structural motif]; Region: leucine-rich repeat" /db_xref="CDD:275380" ORIGIN 1 tcatttgggt tggggcgagc gagcgagcgt cacgttagct ctgggcacag ttacagacac 61 cgttccacac gttcacgttc acttgtcgcg acgagtttca gttggtttcg ctgtttcgtt 121 attcttgatt gtttttctta ttattttgtt gttttttgtt ttctgtgtgt gcttctgctc 181 tgtcccgtct ctgttggatc agatcagaac agatcaacat cgtcatcatc cgttgatctg 241 cgccgtagaa cagcatcgtc gatcagttcc aattgagatc cgtaaacaaa aagcaacgcg 301 atcgcgccga ctctttccaa gtgatccaaa cagaacgaac agaaggaggc ccaagcccaa 361 gcccagccat ggaggtgtac acgtcggaca gctcggacac ggactcgcgc gaccaaaaga 421 ccatcgattt tgggcgcatg agtctcgatt cggttacgct cgaggatcac ctgacatcgc 481 cgcacaaggc cctgctcaag tccagcggcg acattgagac gatgctgctc aaccacaacc 541 gactggtgag cctgccccgg gtcctgcagc agtttgccaa cctcaaggtg ctggatctca 601 gctccaatgc gatcacccag ctgccggatg ccatctgcca gctgccgctg gtcacattga 661 ttgccaagaa caatttgctg accaactgct cgctgcccaa gtcgctgctg gccaagcagg 721 cggccggcgg tggctacgga cacggacaca gcaccctcaa ggagctcaat ctgagcggca 781 accagttgac ccacttcccc gagcaggtca ccgagctgcg ccacctcaag tatctgtatg 841 tgggcggcaa caagataacg ggcatctcga aggacatttg gaagctgcaa agtctgcatg 901 tgctgtcgct gggcggcaac ctgatcagcg aggtgcccga tgctgtgggg tcactcagcc 961 agctgcaggc gctggtcctg tgcgacaatc tcatcgagaa tctgccgatg agcattgccc 1021 ggctgaagaa cctcaagtcg ctgctgctgc acaagaatcg tctgcgccac ttgcccaagg 1081 acattgtggc cctgaagaac ctaacggagt tgagcctgcg cgacaatccg ctggtggtgc 1141 gcttcgtgca ggacatggca ttgaagcccc caacattgct ggagctggct ggccgcattg 1201 tgaaggctag tggccagcgg cccggaccct acgacatacc gcgtaccctg gccgagtatc 1261 tgaacagtgc caactgctgc gtgaacccca actgcaaggg cgtcttcttt gacaatcgcg 1321 tggagcacat caagttcgtg gacttttgcg gcaagtaccg cgtcccgctg ctgcagtatc 1381 tatgcagctc gaagtgcatc gagcatgagg aaccggcgcg cggctccagt gcgagcagca 1441 gcgccaatag cgggttcatg atgcgcaagg tgctcctggg ctaggccgtg cggccccggc 1501 ctggccctgg ccctggctgg cagcaggagt gccatcggag cgtcgtcggt ggctggcatc 1561 gaccggatat cgatatcgga gacggagatc cattcgttgt aaggccgcgg ggccccatgg 1621 caccagcgcc gcgccatcgg ctctggagtt tggcggccgc cgggcccggc ccgtcccacc 1681 ggctcgccgg cacatcccat tggctttatc acgttatcaa gtcaaatttg atctaatttg 1741 ctatatgatt atcgagtcgt tcgctttgtt gttgtttgtt gtttgttgtt tgcttgttgt 1801 tataaagccc gccttcccac acccccccaa agatacc