Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila obscura leucine-rich repeat-containing


LOCUS       XM_022354691            1837 bp    mRNA    linear   INV 14-MAY-2021
            protein 58 (LOC111066243), mRNA.
ACCESSION   XM_022354691
VERSION     XM_022354691.2
DBLINK      BioProject: PRJNA728747
KEYWORDS    RefSeq.
SOURCE      Drosophila obscura
  ORGANISM  Drosophila obscura
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024542752.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On May 14, 2021 this sequence version replaced XM_022354691.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila obscura Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1837
                     /organism="Drosophila obscura"
                     /mol_type="mRNA"
                     /isolate="BZ-5 IFL"
                     /db_xref="taxon:7282"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="whole fly"
                     /dev_stage="Adult fly"
                     /geo_loc_name="Serbia: Babin Zub"
                     /collection_date="2017"
     gene            1..1837
                     /gene="LOC111066243"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 4 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 17 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:111066243"
     CDS             369..1484
                     /gene="LOC111066243"
                     /codon_start=1
                     /product="leucine-rich repeat-containing protein 58"
                     /protein_id="XP_022210383.1"
                     /db_xref="GeneID:111066243"
                     /translation="MEVYTSDSSDTDSRDQKTIDFGRMSLDSVTLEDHLTSPHKALLK
                     SSGDIETMLLNHNRLVSLPRVLQQFANLKVLDLSSNAITQLPDAICQLPLVTLIAKNN
                     LLTNCSLPKSLLAKQAAGGGYGHGHSTLKELNLSGNQLTHFPEQVTELRHLKYLYVGG
                     NKITGISKDIWKLQSLHVLSLGGNLISEVPDAVGSLSQLQALVLCDNLIENLPMSIAR
                     LKNLKSLLLHKNRLRHLPKDIVALKNLTELSLRDNPLVVRFVQDMALKPPTLLELAGR
                     IVKASGQRPGPYDIPRTLAEYLNSANCCVNPNCKGVFFDNRVEHIKFVDFCGKYRVPL
                     LQYLCSSKCIEHEEPARGSSASSSANSGFMMRKVLLG"
     misc_feature    513..581
                     /gene="LOC111066243"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    <546..>1133
                     /gene="LOC111066243"
                     /note="Leucine-rich repeat (LRR) protein [Transcription];
                     Region: LRR; COG4886"
                     /db_xref="CDD:443914"
     misc_feature    582..644
                     /gene="LOC111066243"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    648..755
                     /gene="LOC111066243"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    756..824
                     /gene="LOC111066243"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    825..893
                     /gene="LOC111066243"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    894..962
                     /gene="LOC111066243"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    963..1031
                     /gene="LOC111066243"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    1032..1100
                     /gene="LOC111066243"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
ORIGIN      
        1 tcatttgggt tggggcgagc gagcgagcgt cacgttagct ctgggcacag ttacagacac
       61 cgttccacac gttcacgttc acttgtcgcg acgagtttca gttggtttcg ctgtttcgtt
      121 attcttgatt gtttttctta ttattttgtt gttttttgtt ttctgtgtgt gcttctgctc
      181 tgtcccgtct ctgttggatc agatcagaac agatcaacat cgtcatcatc cgttgatctg
      241 cgccgtagaa cagcatcgtc gatcagttcc aattgagatc cgtaaacaaa aagcaacgcg
      301 atcgcgccga ctctttccaa gtgatccaaa cagaacgaac agaaggaggc ccaagcccaa
      361 gcccagccat ggaggtgtac acgtcggaca gctcggacac ggactcgcgc gaccaaaaga
      421 ccatcgattt tgggcgcatg agtctcgatt cggttacgct cgaggatcac ctgacatcgc
      481 cgcacaaggc cctgctcaag tccagcggcg acattgagac gatgctgctc aaccacaacc
      541 gactggtgag cctgccccgg gtcctgcagc agtttgccaa cctcaaggtg ctggatctca
      601 gctccaatgc gatcacccag ctgccggatg ccatctgcca gctgccgctg gtcacattga
      661 ttgccaagaa caatttgctg accaactgct cgctgcccaa gtcgctgctg gccaagcagg
      721 cggccggcgg tggctacgga cacggacaca gcaccctcaa ggagctcaat ctgagcggca
      781 accagttgac ccacttcccc gagcaggtca ccgagctgcg ccacctcaag tatctgtatg
      841 tgggcggcaa caagataacg ggcatctcga aggacatttg gaagctgcaa agtctgcatg
      901 tgctgtcgct gggcggcaac ctgatcagcg aggtgcccga tgctgtgggg tcactcagcc
      961 agctgcaggc gctggtcctg tgcgacaatc tcatcgagaa tctgccgatg agcattgccc
     1021 ggctgaagaa cctcaagtcg ctgctgctgc acaagaatcg tctgcgccac ttgcccaagg
     1081 acattgtggc cctgaagaac ctaacggagt tgagcctgcg cgacaatccg ctggtggtgc
     1141 gcttcgtgca ggacatggca ttgaagcccc caacattgct ggagctggct ggccgcattg
     1201 tgaaggctag tggccagcgg cccggaccct acgacatacc gcgtaccctg gccgagtatc
     1261 tgaacagtgc caactgctgc gtgaacccca actgcaaggg cgtcttcttt gacaatcgcg
     1321 tggagcacat caagttcgtg gacttttgcg gcaagtaccg cgtcccgctg ctgcagtatc
     1381 tatgcagctc gaagtgcatc gagcatgagg aaccggcgcg cggctccagt gcgagcagca
     1441 gcgccaatag cgggttcatg atgcgcaagg tgctcctggg ctaggccgtg cggccccggc
     1501 ctggccctgg ccctggctgg cagcaggagt gccatcggag cgtcgtcggt ggctggcatc
     1561 gaccggatat cgatatcgga gacggagatc cattcgttgt aaggccgcgg ggccccatgg
     1621 caccagcgcc gcgccatcgg ctctggagtt tggcggccgc cgggcccggc ccgtcccacc
     1681 ggctcgccgg cacatcccat tggctttatc acgttatcaa gtcaaatttg atctaatttg
     1741 ctatatgatt atcgagtcgt tcgctttgtt gttgtttgtt gtttgttgtt tgcttgttgt
     1801 tataaagccc gccttcccac acccccccaa agatacc