PREDICTED: Drosophila obscura uncharacterized LOC111066241

LOCUS       XM_022354689             606 bp    mRNA    linear   INV 14-MAY-2021
            (LOC111066241), mRNA.
ACCESSION   XM_022354689
VERSION     XM_022354689.2
DBLINK      BioProject: PRJNA728747
KEYWORDS    RefSeq.
SOURCE      Drosophila obscura
  ORGANISM  Drosophila obscura
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024542752.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On May 14, 2021 this sequence version replaced XM_022354689.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila obscura Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..606
                     /organism="Drosophila obscura"
                     /mol_type="mRNA"
                     /isolate="BZ-5 IFL"
                     /db_xref="taxon:7282"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="whole fly"
                     /dev_stage="Adult fly"
                     /geo_loc_name="Serbia: Babin Zub"
                     /collection_date="2017"
     gene            1..606
                     /gene="LOC111066241"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 100% coverage of the annotated
                     genomic feature by RNAseq alignments, including 6 samples
                     with support for all annotated introns"
                     /db_xref="GeneID:111066241"
     CDS             87..539
                     /gene="LOC111066241"
                     /codon_start=1
                     /product="uncharacterized protein LOC111066241"
                     /protein_id="XP_022210381.1"
                     /db_xref="GeneID:111066241"
                     /translation="MDFRKRFTRRNIPKLCIGKSSLDRLAFRPDIYNFRHGIGIKAII
                     ARKKSLMPFRRFRMLQTISAIDLMPTQDPTLACTYLADMGEKRPQRPGRFELLLILCL
                     LAISIFSLSQVAMSGFAFISKKYLILKVLGLARFANVSSSFYMFEKWV"
ORIGIN      
        1 gacaaagtcg agcctagtgg gtttggcata atcaatcctg tgtgttgcta catattcaca
       61 ttccgtttta gttgtaaaat tcaattatgg attttcgtaa gcgatttacc agaaggaata
      121 tccccaagct gtgcataggc aagtcatcgc tggatcggct agcctttcgg ccggatatat
      181 acaattttcg ccatggcatt ggcataaagg caatcattgc cagaaagaaa tcgttgatgc
      241 ccttccggcg gttccggatg ctccaaacta taagcgccat tgacctaatg cccactcaag
      301 acccaacgct tgcgtgcact tatctggctg acatggggga gaagcgtccc cagcgaccag
      361 gacgctttga gctgctgctg attttgtgcc tcttggccat tagcatcttt agtctttccc
      421 aagtggcaat gagcggcttt gcgttcatat cgaagaagta tctgatactc aaagtgttgg
      481 gcttggcgcg ttttgccaac gtttcctcat cgttttatat gttcgaaaaa tgggtttaac
      541 ttttacaaca tttacacaca acaatacaca atatcttata ttatttataa taaatttaat
      601 tatggg