Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_022354686 798 bp mRNA linear INV 14-MAY-2021 (LOC111066239), mRNA. ACCESSION XM_022354686 VERSION XM_022354686.2 DBLINK BioProject: PRJNA728747 KEYWORDS RefSeq. SOURCE Drosophila obscura ORGANISM Drosophila obscura Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_024542752.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On May 14, 2021 this sequence version replaced XM_022354686.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Drosophila obscura Annotation Release 101 Annotation Version :: 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.6 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..798 /organism="Drosophila obscura" /mol_type="mRNA" /isolate="BZ-5 IFL" /db_xref="taxon:7282" /chromosome="Unknown" /sex="male" /tissue_type="whole fly" /dev_stage="Adult fly" /geo_loc_name="Serbia: Babin Zub" /collection_date="2017" gene 1..798 /gene="LOC111066239" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein, and 12% coverage of the annotated genomic feature by RNAseq alignments" /db_xref="GeneID:111066239" CDS 1..798 /gene="LOC111066239" /codon_start=1 /product="uncharacterized protein LOC111066239" /protein_id="XP_022210378.2" /db_xref="GeneID:111066239" /translation="MGCCSSSMKIKELTARPELDGSIYLAAGNGNGGSGKRLYSSRNS SGMGSSSSSCSNSSNRSIWSRSRAICDDFSEQPQQQQQGSEQEQELELERSCGYYTCS SSASTPTKQQQRQLMRTQDMGNSSQESTESTPMVSNLEWEMYMMQQAQRIMPKTSSPI SQRRAAAGGDSYNKWRNYLQGTPAHMLHNVSHIPEAIAGHFCPTTFPAFSDLEEMESA AKRFKVDVQIEEEGKEEEMEAMEQEQEPLYTTSQLLAGHTHTITTDL" ORIGIN 1 atgggttgtt gttcgagcag catgaaaatc aaagagctga cagccaggcc agagctggat 61 ggcagcatct acttggcggc aggcaacggc aatggtggca gtggcaagcg gctgtacagc 121 agtcgcaaca gcagcggcat gggcagcagc agcagctcct gcagcaacag cagcaatcgt 181 agcatctgga gccgctccag ggccatctgc gatgacttct ccgagcagcc acagcagcag 241 cagcaagggt cagagcagga gcaggagctg gagctggagc gctcctgtgg ctactacaca 301 tgcagcagct cggcctcaac gcccacaaag cagcagcagc gccaactgat gcgcacccag 361 gacatgggca acagttccca ggagtccact gaatccacac cgatggtcag caatctcgag 421 tgggagatgt acatgatgca gcaggcgcag cgcattatgc caaagacctc gtcgcccatc 481 agccagcgac gcgctgcggc tggcggtgac tcctacaaca agtggcgcaa ctatctgcag 541 ggcacacccg cccacatgct gcacaatgtc agccacatac cggaggccat tgccggccac 601 ttctgcccca ccacctttcc ggcctttagc gatctagagg aaatggagag tgcggccaag 661 cgcttcaagg tggatgtgca aatcgaggag gaggggaagg aggaggaaat ggaggcaatg 721 gagcaggagc aggagccact gtacaccacc tcacagctgc tggcggggca tacgcacacc 781 atcaccacag acctgtag