Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila obscura uncharacterized LOC111066239


LOCUS       XM_022354686             798 bp    mRNA    linear   INV 14-MAY-2021
            (LOC111066239), mRNA.
ACCESSION   XM_022354686
VERSION     XM_022354686.2
DBLINK      BioProject: PRJNA728747
KEYWORDS    RefSeq.
SOURCE      Drosophila obscura
  ORGANISM  Drosophila obscura
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024542752.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On May 14, 2021 this sequence version replaced XM_022354686.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila obscura Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..798
                     /organism="Drosophila obscura"
                     /mol_type="mRNA"
                     /isolate="BZ-5 IFL"
                     /db_xref="taxon:7282"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="whole fly"
                     /dev_stage="Adult fly"
                     /geo_loc_name="Serbia: Babin Zub"
                     /collection_date="2017"
     gene            1..798
                     /gene="LOC111066239"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 1 Protein, and 12% coverage of the
                     annotated genomic feature by RNAseq alignments"
                     /db_xref="GeneID:111066239"
     CDS             1..798
                     /gene="LOC111066239"
                     /codon_start=1
                     /product="uncharacterized protein LOC111066239"
                     /protein_id="XP_022210378.2"
                     /db_xref="GeneID:111066239"
                     /translation="MGCCSSSMKIKELTARPELDGSIYLAAGNGNGGSGKRLYSSRNS
                     SGMGSSSSSCSNSSNRSIWSRSRAICDDFSEQPQQQQQGSEQEQELELERSCGYYTCS
                     SSASTPTKQQQRQLMRTQDMGNSSQESTESTPMVSNLEWEMYMMQQAQRIMPKTSSPI
                     SQRRAAAGGDSYNKWRNYLQGTPAHMLHNVSHIPEAIAGHFCPTTFPAFSDLEEMESA
                     AKRFKVDVQIEEEGKEEEMEAMEQEQEPLYTTSQLLAGHTHTITTDL"
ORIGIN      
        1 atgggttgtt gttcgagcag catgaaaatc aaagagctga cagccaggcc agagctggat
       61 ggcagcatct acttggcggc aggcaacggc aatggtggca gtggcaagcg gctgtacagc
      121 agtcgcaaca gcagcggcat gggcagcagc agcagctcct gcagcaacag cagcaatcgt
      181 agcatctgga gccgctccag ggccatctgc gatgacttct ccgagcagcc acagcagcag
      241 cagcaagggt cagagcagga gcaggagctg gagctggagc gctcctgtgg ctactacaca
      301 tgcagcagct cggcctcaac gcccacaaag cagcagcagc gccaactgat gcgcacccag
      361 gacatgggca acagttccca ggagtccact gaatccacac cgatggtcag caatctcgag
      421 tgggagatgt acatgatgca gcaggcgcag cgcattatgc caaagacctc gtcgcccatc
      481 agccagcgac gcgctgcggc tggcggtgac tcctacaaca agtggcgcaa ctatctgcag
      541 ggcacacccg cccacatgct gcacaatgtc agccacatac cggaggccat tgccggccac
      601 ttctgcccca ccacctttcc ggcctttagc gatctagagg aaatggagag tgcggccaag
      661 cgcttcaagg tggatgtgca aatcgaggag gaggggaagg aggaggaaat ggaggcaatg
      721 gagcaggagc aggagccact gtacaccacc tcacagctgc tggcggggca tacgcacacc
      781 atcaccacag acctgtag