Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_022354683 678 bp mRNA linear INV 14-MAY-2021 (LOC111066235), mRNA. ACCESSION XM_022354683 VERSION XM_022354683.2 DBLINK BioProject: PRJNA728747 KEYWORDS RefSeq. SOURCE Drosophila obscura ORGANISM Drosophila obscura Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_024542752.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On May 14, 2021 this sequence version replaced XM_022354683.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Drosophila obscura Annotation Release 101 Annotation Version :: 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.6 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..678 /organism="Drosophila obscura" /mol_type="mRNA" /isolate="BZ-5 IFL" /db_xref="taxon:7282" /chromosome="Unknown" /sex="male" /tissue_type="whole fly" /dev_stage="Adult fly" /geo_loc_name="Serbia: Babin Zub" /collection_date="2017" gene 1..678 /gene="LOC111066235" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein, and 100% coverage of the annotated genomic feature by RNAseq alignments" /db_xref="GeneID:111066235" CDS 54..608 /gene="LOC111066235" /codon_start=1 /product="augmin complex subunit dgt4" /protein_id="XP_022210375.2" /db_xref="GeneID:111066235" /translation="MEPSTFIATENGIEDIQYLMHLEAIKRFTDDNKNVQGNVEEQAR NWQDAKCEYQSHYSRLVRISKCCLLANAAATQKSVATDQVARMANDVRTLASKISSDK QATILNQNAMEQSTINLKTGHRARSLLSKQQRNCADNQETLKSVHESVELVENRLEAT TVLALDNLIRELPPRESSKNVDSS" ORIGIN 1 gtcatcgaaa atcatatttc gataagattg cagacatttt aaaaaaatgt aaaatggaac 61 cctctacatt tatagctaca gaaaatggta tcgaagatat acaatattta atgcacctag 121 aagccatcaa gcgtttcacc gacgacaaca aaaacgttca aggcaatgtg gaggagcagg 181 cgcgcaactg gcaagacgcc aagtgcgagt accaaagcca ctacagtcgc ttggtccgca 241 tttccaaatg ctgcttgcta gcgaacgctg cagccaccca gaaaagcgtt gctaccgacc 301 aggttgcacg tatggccaac gatgtgagaa cgttggcgtc caaaatttcc agcgacaaac 361 aagctacaat cctgaaccag aatgccatgg agcagtccac aatcaacctg aagacgggcc 421 accgcgcgcg ctcgctgctt agcaagcagc agcgaaactg tgccgataat caggagaccc 481 tcaagtcggt gcacgaatct gtggaacttg tggagaaccg cttggaagcg actactgttc 541 tggctctgga caatctgatc agagagttgc ccccgaggga atcgagcaag aatgttgatt 601 cgtcgtaaat atatttggaa tacatggatt ctttgtacat taataaaagc gcaacagatt 661 taagctataa tctacgaa