Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila obscura augmin complex subunit dgt4


LOCUS       XM_022354683             678 bp    mRNA    linear   INV 14-MAY-2021
            (LOC111066235), mRNA.
ACCESSION   XM_022354683
VERSION     XM_022354683.2
DBLINK      BioProject: PRJNA728747
KEYWORDS    RefSeq.
SOURCE      Drosophila obscura
  ORGANISM  Drosophila obscura
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024542752.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On May 14, 2021 this sequence version replaced XM_022354683.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila obscura Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..678
                     /organism="Drosophila obscura"
                     /mol_type="mRNA"
                     /isolate="BZ-5 IFL"
                     /db_xref="taxon:7282"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="whole fly"
                     /dev_stage="Adult fly"
                     /geo_loc_name="Serbia: Babin Zub"
                     /collection_date="2017"
     gene            1..678
                     /gene="LOC111066235"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 1 Protein, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments"
                     /db_xref="GeneID:111066235"
     CDS             54..608
                     /gene="LOC111066235"
                     /codon_start=1
                     /product="augmin complex subunit dgt4"
                     /protein_id="XP_022210375.2"
                     /db_xref="GeneID:111066235"
                     /translation="MEPSTFIATENGIEDIQYLMHLEAIKRFTDDNKNVQGNVEEQAR
                     NWQDAKCEYQSHYSRLVRISKCCLLANAAATQKSVATDQVARMANDVRTLASKISSDK
                     QATILNQNAMEQSTINLKTGHRARSLLSKQQRNCADNQETLKSVHESVELVENRLEAT
                     TVLALDNLIRELPPRESSKNVDSS"
ORIGIN      
        1 gtcatcgaaa atcatatttc gataagattg cagacatttt aaaaaaatgt aaaatggaac
       61 cctctacatt tatagctaca gaaaatggta tcgaagatat acaatattta atgcacctag
      121 aagccatcaa gcgtttcacc gacgacaaca aaaacgttca aggcaatgtg gaggagcagg
      181 cgcgcaactg gcaagacgcc aagtgcgagt accaaagcca ctacagtcgc ttggtccgca
      241 tttccaaatg ctgcttgcta gcgaacgctg cagccaccca gaaaagcgtt gctaccgacc
      301 aggttgcacg tatggccaac gatgtgagaa cgttggcgtc caaaatttcc agcgacaaac
      361 aagctacaat cctgaaccag aatgccatgg agcagtccac aatcaacctg aagacgggcc
      421 accgcgcgcg ctcgctgctt agcaagcagc agcgaaactg tgccgataat caggagaccc
      481 tcaagtcggt gcacgaatct gtggaacttg tggagaaccg cttggaagcg actactgttc
      541 tggctctgga caatctgatc agagagttgc ccccgaggga atcgagcaag aatgttgatt
      601 cgtcgtaaat atatttggaa tacatggatt ctttgtacat taataaaagc gcaacagatt
      661 taagctataa tctacgaa