Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_022354681 527 bp mRNA linear INV 14-MAY-2021 (LOC111066233), mRNA. ACCESSION XM_022354681 VERSION XM_022354681.2 DBLINK BioProject: PRJNA728747 KEYWORDS RefSeq. SOURCE Drosophila obscura ORGANISM Drosophila obscura Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_024542752.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On May 14, 2021 this sequence version replaced XM_022354681.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Drosophila obscura Annotation Release 101 Annotation Version :: 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.6 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..527 /organism="Drosophila obscura" /mol_type="mRNA" /isolate="BZ-5 IFL" /db_xref="taxon:7282" /chromosome="Unknown" /sex="male" /tissue_type="whole fly" /dev_stage="Adult fly" /geo_loc_name="Serbia: Babin Zub" /collection_date="2017" gene 1..527 /gene="LOC111066233" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments" /db_xref="GeneID:111066233" CDS 89..433 /gene="LOC111066233" /codon_start=1 /product="uncharacterized protein LOC111066233" /protein_id="XP_022210373.2" /db_xref="GeneID:111066233" /translation="MALFEMKWLRRMVRRNTSPIPEHRAEMWKRRLSIGYAILAWHAF GLVCYMVYTGRNDWAKYYGYKTEEEMALSPAQQFAKHLKVEGTGKIIRYSGFKKVEEI PFDSSTVEKVKE" ORIGIN 1 ctgatcggac accatttgtt tacgatttgt gcaacggcgg catcgcaacg cgctttacat 61 aactgttgtt tctattaaat acaaaactat ggcgctcttc gagatgaaat ggcttcgccg 121 catggtgcgg cggaacacaa gccccatacc ggagcaccgc gccgaaatgt ggaagcgacg 181 cctcagcatt ggctatgcga ttctggcctg gcacgccttc ggcctggtct gctacatggt 241 ctacaccggg cgcaacgact gggctaaata ctatggctac aagacggagg aggaaatggc 301 cctgtcgccg gcccaacagt tcgccaagca cctcaaagtg gagggaactg gcaaaatcat 361 acgctactcg ggcttcaaga aggtagagga gataccattc gactccagca ctgtggaaaa 421 agtaaaggag taaagcagac atttagatta tagttaatat catttttttt tgtcctaaca 481 attgattgca atcaaagaaa gtatataaac aaaagcaagg tctggta