Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_019475463 573 bp mRNA linear PLN 18-APR-2022 ACCESSION XM_019475463 VERSION XM_019475463.1 DBLINK BioProject: PRJNA14005 BioSample: SAMN02953594 KEYWORDS RefSeq. SOURCE Candida albicans SC5314 ORGANISM Candida albicans SC5314 Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade; Candida. REFERENCE 1 (bases 1 to 573) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Assembly of a phased diploid Candida albicans genome facilitates allele-specific measurements and provides a simple model for repeat and indel structure JOURNAL Genome Biol. 14 (9), R97 (2013) PUBMED 24025428 REFERENCE 2 (bases 1 to 573) AUTHORS van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D., Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B., Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T. TITLE Assembly of the Candida albicans genome into sixteen supercontigs aligned on the eight chromosomes JOURNAL Genome Biol. 8 (4), R52 (2007) PUBMED 17419877 REFERENCE 3 (bases 1 to 573) AUTHORS Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S., Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T., Davis,R.W. and Scherer,S. TITLE The diploid genome sequence of Candida albicans JOURNAL Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004) PUBMED 15123810 REFERENCE 4 (bases 1 to 573) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (15-APR-2022) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 5 (bases 1 to 573) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Direct Submission JOURNAL Submitted (04-OCT-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REFERENCE 6 (bases 1 to 573) CONSRTM Candida Genome Database TITLE Direct Submission JOURNAL Submitted (30-SEP-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REMARK Sequence and annotation update by submitter COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NC_032094). ##Genome-Annotation-Data-START## Annotation Provider :: CGD Annotation Status :: Full annotation Annotation Version :: A22-s07-m01-r01 URL :: http://www.candidagenome.org/ ##Genome-Annotation-Data-END## COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..573 /organism="Candida albicans SC5314" /mol_type="mRNA" /strain="SC5314" /host="Homo sapiens" /culture_collection="ATCC:MYA-2876" /db_xref="taxon:237561" /chromosome="6" /haplotype="A" /geo_loc_name="USA: New York" /collected_by="Margarita Silva-Hutner" gene <1..>573 /gene="SAR1" /locus_tag="CAALFM_C602220WA" /db_xref="GeneID:3645865" CDS 1..573 /gene="SAR1" /locus_tag="CAALFM_C602220WA" /note="Functional homolog of S. cerevisiae Sar1; which is required for ER-to-Golgi protein transport; binds GTP; similar to small GTPase superfamily proteins; gene has intron; Hap43-induced; rat catheter biofilm repressed" /codon_start=1 /transl_table=12 /product="Arf family GTPase" /protein_id="XP_019331008.1" /db_xref="CGD:CAL0000177161" /db_xref="GeneID:3645865" /translation="MWIFDWFQDILSSLGLWNKHAKLLFLGLDNAGKTTLLHMLKNDR LATLQPTLHPTSEELAIGSVRFTTFDLGGHQQARRLWKDYFPEVNGIVFLVDAADTER FAESKAELESLFRIEELSQVPFVILGNKIDVPTAVGEMELKNALGLYNTTGKDTGKLP EGTRPIEVFMVSVVMRSGYGEAFKWLSQYI" misc_feature 10..570 /gene="SAR1" /locus_tag="CAALFM_C602220WA" /note="Sar1p-like members of the Ras-family of small GTPases; Region: SAR; smart00178" /db_xref="CDD:197556" ORIGIN 1 atgtggattt ttgactggtt tcaagatata ttatcatcat taggattatg gaataaacat 61 gccaaattat tatttttagg gttagataat gctggtaaaa ctactctttt acatatgtta 121 aagaatgata gattggccac tttacaacca acattacatc caacttcaga agaattggcc 181 attggatcag ttagatttac tacttttgat ttaggtggac atcaacaagc tagaagatta 241 tggaaagatt atttccctga agtcaatggt attgtctttt tagtcgatgc tgctgatacc 301 gaaagatttg ctgaatccaa agctgaattg gaaagtttat ttagaattga agaattgagt 361 caagttccat ttgttatttt gggtaataag attgatgttc ctactgcagt aggggaaatg 421 gaattgaaaa atgcccttgg attatataat actactggta aagatactgg taaattgcct 481 gaaggtacta gaccaattga agtgtttatg gtttccgttg ttatgagatc tggatatggt 541 gaagccttca aatggttatc acaatacatt taa