Candida albicans SC5314 Arf family GTPase (SAR1), partial mRNA.

LOCUS       XM_019475463             573 bp    mRNA    linear   PLN 18-APR-2022
ACCESSION   XM_019475463
VERSION     XM_019475463.1
DBLINK      BioProject: PRJNA14005
            BioSample: SAMN02953594
KEYWORDS    RefSeq.
SOURCE      Candida albicans SC5314
  ORGANISM  Candida albicans SC5314
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade;
            Candida.
REFERENCE   1  (bases 1 to 573)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Assembly of a phased diploid Candida albicans genome facilitates
            allele-specific measurements and provides a simple model for repeat
            and indel structure
  JOURNAL   Genome Biol. 14 (9), R97 (2013)
   PUBMED   24025428
REFERENCE   2  (bases 1 to 573)
  AUTHORS   van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D.,
            Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B.,
            Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T.
  TITLE     Assembly of the Candida albicans genome into sixteen supercontigs
            aligned on the eight chromosomes
  JOURNAL   Genome Biol. 8 (4), R52 (2007)
   PUBMED   17419877
REFERENCE   3  (bases 1 to 573)
  AUTHORS   Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S.,
            Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T.,
            Davis,R.W. and Scherer,S.
  TITLE     The diploid genome sequence of Candida albicans
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004)
   PUBMED   15123810
REFERENCE   4  (bases 1 to 573)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-APR-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   5  (bases 1 to 573)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-OCT-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
REFERENCE   6  (bases 1 to 573)
  CONSRTM   Candida Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (30-SEP-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
  REMARK    Sequence and annotation update by submitter
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_032094).
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: CGD
            Annotation Status   :: Full annotation
            Annotation Version  :: A22-s07-m01-r01
            URL                 :: http://www.candidagenome.org/
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..573
                     /organism="Candida albicans SC5314"
                     /mol_type="mRNA"
                     /strain="SC5314"
                     /host="Homo sapiens"
                     /culture_collection="ATCC:MYA-2876"
                     /db_xref="taxon:237561"
                     /chromosome="6"
                     /haplotype="A"
                     /geo_loc_name="USA: New York"
                     /collected_by="Margarita Silva-Hutner"
     gene            <1..>573
                     /gene="SAR1"
                     /locus_tag="CAALFM_C602220WA"
                     /db_xref="GeneID:3645865"
     CDS             1..573
                     /gene="SAR1"
                     /locus_tag="CAALFM_C602220WA"
                     /note="Functional homolog of S. cerevisiae Sar1; which is
                     required for ER-to-Golgi protein transport; binds GTP;
                     similar to small GTPase superfamily proteins; gene has
                     intron; Hap43-induced; rat catheter biofilm repressed"
                     /codon_start=1
                     /transl_table=12
                     /product="Arf family GTPase"
                     /protein_id="XP_019331008.1"
                     /db_xref="CGD:CAL0000177161"
                     /db_xref="GeneID:3645865"
                     /translation="MWIFDWFQDILSSLGLWNKHAKLLFLGLDNAGKTTLLHMLKNDR
                     LATLQPTLHPTSEELAIGSVRFTTFDLGGHQQARRLWKDYFPEVNGIVFLVDAADTER
                     FAESKAELESLFRIEELSQVPFVILGNKIDVPTAVGEMELKNALGLYNTTGKDTGKLP
                     EGTRPIEVFMVSVVMRSGYGEAFKWLSQYI"
     misc_feature    10..570
                     /gene="SAR1"
                     /locus_tag="CAALFM_C602220WA"
                     /note="Sar1p-like members of the Ras-family of small
                     GTPases; Region: SAR; smart00178"
                     /db_xref="CDD:197556"
ORIGIN      
        1 atgtggattt ttgactggtt tcaagatata ttatcatcat taggattatg gaataaacat
       61 gccaaattat tatttttagg gttagataat gctggtaaaa ctactctttt acatatgtta
      121 aagaatgata gattggccac tttacaacca acattacatc caacttcaga agaattggcc
      181 attggatcag ttagatttac tacttttgat ttaggtggac atcaacaagc tagaagatta
      241 tggaaagatt atttccctga agtcaatggt attgtctttt tagtcgatgc tgctgatacc
      301 gaaagatttg ctgaatccaa agctgaattg gaaagtttat ttagaattga agaattgagt
      361 caagttccat ttgttatttt gggtaataag attgatgttc ctactgcagt aggggaaatg
      421 gaattgaaaa atgcccttgg attatataat actactggta aagatactgg taaattgcct
      481 gaaggtacta gaccaattga agtgtttatg gtttccgttg ttatgagatc tggatatggt
      541 gaagccttca aatggttatc acaatacatt taa