Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_019475459 459 bp mRNA linear PLN 18-APR-2022 ACCESSION XM_019475459 VERSION XM_019475459.1 DBLINK BioProject: PRJNA14005 BioSample: SAMN02953594 KEYWORDS RefSeq. SOURCE Candida albicans SC5314 ORGANISM Candida albicans SC5314 Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade; Candida. REFERENCE 1 (bases 1 to 459) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Assembly of a phased diploid Candida albicans genome facilitates allele-specific measurements and provides a simple model for repeat and indel structure JOURNAL Genome Biol. 14 (9), R97 (2013) PUBMED 24025428 REFERENCE 2 (bases 1 to 459) AUTHORS van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D., Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B., Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T. TITLE Assembly of the Candida albicans genome into sixteen supercontigs aligned on the eight chromosomes JOURNAL Genome Biol. 8 (4), R52 (2007) PUBMED 17419877 REFERENCE 3 (bases 1 to 459) AUTHORS Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S., Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T., Davis,R.W. and Scherer,S. TITLE The diploid genome sequence of Candida albicans JOURNAL Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004) PUBMED 15123810 REFERENCE 4 (bases 1 to 459) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (15-APR-2022) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 5 (bases 1 to 459) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Direct Submission JOURNAL Submitted (04-OCT-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REFERENCE 6 (bases 1 to 459) CONSRTM Candida Genome Database TITLE Direct Submission JOURNAL Submitted (30-SEP-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REMARK Sequence and annotation update by submitter COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NC_032094). ##Genome-Annotation-Data-START## Annotation Provider :: CGD Annotation Status :: Full annotation Annotation Version :: A22-s07-m01-r01 URL :: http://www.candidagenome.org/ ##Genome-Annotation-Data-END## COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..459 /organism="Candida albicans SC5314" /mol_type="mRNA" /strain="SC5314" /host="Homo sapiens" /culture_collection="ATCC:MYA-2876" /db_xref="taxon:237561" /chromosome="6" /haplotype="A" /geo_loc_name="USA: New York" /collected_by="Margarita Silva-Hutner" gene <1..>459 /gene="HCH1" /locus_tag="CAALFM_C601860CA" /db_xref="GeneID:3641626" CDS 1..459 /gene="HCH1" /locus_tag="CAALFM_C601860CA" /note="Ortholog of S. cerevisiae Hch1, a regulator of heat shock protein Hsp90; regulated by Gcn4; induced in response to amino acid starvation (3-aminotriazole treatment); mutants are viable" /codon_start=1 /transl_table=12 /product="Hch1p" /protein_id="XP_019331004.1" /db_xref="CGD:CAL0000176856" /db_xref="GeneID:3641626" /translation="MVVHNPNNWHWIDKNCLPWSKDYLKENIIDTTYEDDSFRFVVTA VDSVSGDCDVTQRKGKVLCIYDMRLQFSLSGAIKKGNEKEEEETISATIVIPEFVHDQ DKDEYVFEIESASQKSEIRKYFVPILKEKLMKFQPDLLEAHAKDVQHATD" misc_feature 37..429 /gene="HCH1" /locus_tag="CAALFM_C601860CA" /note="Activator of Hsp90 ATPase, N-terminal; Region: Aha1_N; pfam09229" /db_xref="CDD:462716" ORIGIN 1 atggtagttc acaaccctaa caattggcat tggattgaca aaaactgttt gccctggtcc 61 aaagactatt tgaaggagaa tataatagac actacatacg aagatgacct gttcagattt 121 gtagtcactg ctgttgattc tgtcagtggt gattgtgatg tgactcaaag aaaggggaag 181 gtgttatgca tatacgatat gagattacaa tttctgttat ctggagctat caaaaagggc 241 aatgagaagg aggaagaaga aacaatatca gcaacaattg ttataccaga atttgttcat 301 gatcaagata aagacgaata cgtttttgag atagaatctg cttctcaaaa atcagaaatt 361 agaaagtact ttgtaccaat cttaaaggag aaattgatga aatttcaacc tgatttactt 421 gaagcacatg caaaagatgt tcaacacgca actgattaa