Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

Candida albicans SC5314 translation elongation factor eIF-5A


LOCUS       XM_019475454             477 bp    mRNA    linear   PLN 18-APR-2022
            (ANB1), partial mRNA.
ACCESSION   XM_019475454
VERSION     XM_019475454.1
DBLINK      BioProject: PRJNA14005
            BioSample: SAMN02953594
KEYWORDS    RefSeq.
SOURCE      Candida albicans SC5314
  ORGANISM  Candida albicans SC5314
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade;
            Candida.
REFERENCE   1  (bases 1 to 477)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Assembly of a phased diploid Candida albicans genome facilitates
            allele-specific measurements and provides a simple model for repeat
            and indel structure
  JOURNAL   Genome Biol. 14 (9), R97 (2013)
   PUBMED   24025428
REFERENCE   2  (bases 1 to 477)
  AUTHORS   van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D.,
            Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B.,
            Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T.
  TITLE     Assembly of the Candida albicans genome into sixteen supercontigs
            aligned on the eight chromosomes
  JOURNAL   Genome Biol. 8 (4), R52 (2007)
   PUBMED   17419877
REFERENCE   3  (bases 1 to 477)
  AUTHORS   Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S.,
            Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T.,
            Davis,R.W. and Scherer,S.
  TITLE     The diploid genome sequence of Candida albicans
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004)
   PUBMED   15123810
REFERENCE   4  (bases 1 to 477)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-APR-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   5  (bases 1 to 477)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-OCT-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
REFERENCE   6  (bases 1 to 477)
  CONSRTM   Candida Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (30-SEP-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
  REMARK    Sequence and annotation update by submitter
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_032094).
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: CGD
            Annotation Status   :: Full annotation
            Annotation Version  :: A22-s07-m01-r01
            URL                 :: http://www.candidagenome.org/
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..477
                     /organism="Candida albicans SC5314"
                     /mol_type="mRNA"
                     /strain="SC5314"
                     /host="Homo sapiens"
                     /culture_collection="ATCC:MYA-2876"
                     /db_xref="taxon:237561"
                     /chromosome="6"
                     /haplotype="A"
                     /geo_loc_name="USA: New York"
                     /collected_by="Margarita Silva-Hutner"
     gene            <1..>477
                     /gene="ANB1"
                     /locus_tag="CAALFM_C601610WA"
                     /db_xref="GeneID:3641648"
     CDS             1..477
                     /gene="ANB1"
                     /locus_tag="CAALFM_C601610WA"
                     /note="Translation initiation factor eIF-5A; repressed in
                     hyphae vs yeast cells; downregulated upon phagocytosis by
                     murine macrophage; Hap43-induced; GlcNAc-induced protein;
                     Spider biofilm repressed"
                     /codon_start=1
                     /transl_table=12
                     /product="translation elongation factor eIF-5A"
                     /protein_id="XP_019330999.1"
                     /db_xref="CGD:CAL0000197571"
                     /db_xref="GeneID:3641648"
                     /translation="MAEEDHTFETADAGAALTFPMQCSALRKNGHVVIKNRPCKIVDM
                     STSKTGKHGHAKVHLVAIDIFTGKKLEDLSPSTHNMEVPNVSRQEFQLLDIDDGYLSL
                     MTADGDTKDDVKVPEGELGDKLQSEFDEGKDLIVTIISAMGEEAAISYKEAPKGSA"
     misc_feature    1..465
                     /gene="ANB1"
                     /locus_tag="CAALFM_C601610WA"
                     /note="eukaryotic translation initiation factor 5A;
                     Provisional; Region: PLN03107"
                     /db_xref="CDD:215580"
ORIGIN      
        1 atggctgaag aagatcacac ttttgaaacc gctgatgccg gtgctgcttt aactttccca
       61 atgcaatgtt ccgctttaag aaagaacggt cacgttgtca ttaagaacag accatgtaaa
      121 attgttgata tgtctacttc taaaaccggt aagcacggtc acgctaaagt ccatttagtt
      181 gccattgata ttttcactgg taaaaaatta gaagatttat ctccatctac ccacaatatg
      241 gaagttccaa atgtctctag acaagaattc caattgttag acattgatga tggttatttg
      301 tctttaatga ctgctgatgg tgacaccaaa gatgatgtca aagtcccaga aggtgaattg
      361 ggtgacaagt tacaatccga attcgatgaa ggtaaagatt tgattgttac catcatttct
      421 gccatgggtg aagaagctgc tatttcttac aaagaagctc caaaaggttc tgcttaa