Candida albicans SC5314 uncharacterized protein (CAALFM_C601090CA),

LOCUS       XM_019475449             840 bp    mRNA    linear   PLN 18-APR-2022
            partial mRNA.
ACCESSION   XM_019475449
VERSION     XM_019475449.1
DBLINK      BioProject: PRJNA14005
            BioSample: SAMN02953594
KEYWORDS    RefSeq.
SOURCE      Candida albicans SC5314
  ORGANISM  Candida albicans SC5314
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade;
            Candida.
REFERENCE   1  (bases 1 to 840)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Assembly of a phased diploid Candida albicans genome facilitates
            allele-specific measurements and provides a simple model for repeat
            and indel structure
  JOURNAL   Genome Biol. 14 (9), R97 (2013)
   PUBMED   24025428
REFERENCE   2  (bases 1 to 840)
  AUTHORS   van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D.,
            Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B.,
            Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T.
  TITLE     Assembly of the Candida albicans genome into sixteen supercontigs
            aligned on the eight chromosomes
  JOURNAL   Genome Biol. 8 (4), R52 (2007)
   PUBMED   17419877
REFERENCE   3  (bases 1 to 840)
  AUTHORS   Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S.,
            Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T.,
            Davis,R.W. and Scherer,S.
  TITLE     The diploid genome sequence of Candida albicans
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004)
   PUBMED   15123810
REFERENCE   4  (bases 1 to 840)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-APR-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   5  (bases 1 to 840)
  AUTHORS   Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-OCT-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
REFERENCE   6  (bases 1 to 840)
  CONSRTM   Candida Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (30-SEP-2016) Department of Genetics, Candida Genome
            Database, Stanford University, Mail Stop-5120, Stanford, CA 94305,
            USA
  REMARK    Sequence and annotation update by submitter
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_032094).
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: CGD
            Annotation Status   :: Full annotation
            Annotation Version  :: A22-s07-m01-r01
            URL                 :: http://www.candidagenome.org/
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..840
                     /organism="Candida albicans SC5314"
                     /mol_type="mRNA"
                     /strain="SC5314"
                     /host="Homo sapiens"
                     /culture_collection="ATCC:MYA-2876"
                     /db_xref="taxon:237561"
                     /chromosome="6"
                     /haplotype="A"
                     /geo_loc_name="USA: New York"
                     /collected_by="Margarita Silva-Hutner"
     gene            <1..>840
                     /locus_tag="CAALFM_C601090CA"
                     /db_xref="GeneID:3644020"
     CDS             1..840
                     /locus_tag="CAALFM_C601090CA"
                     /note="Ortholog of Candida tropicalis MYA-3404 :
                     CTRG_02973 and Candida albicans WO-1 : CAWG_05252"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_019330994.1"
                     /db_xref="CGD:CAL0000195032"
                     /db_xref="GeneID:3644020"
                     /translation="MWITYHKDDPRGEYKHLSPETNYTVGRDENTDIKFWSPKVSREL
                     IELITGPNIGNTQPPSSSSSSSSIGSDKTLLIIRICSRAKTIINGKTYKLLSKDSKPE
                     EIDFTNEFKLKIETIPQIDKQTGQIITQDTPLFIEWIPFKLYISANEKCDQNHYKTII
                     KDHGIDIQIVDNIMDATHYYYDSDNGNNHIKSEEQKDEFKLAIIKGIPILNSQWLQKV
                     LGHDNEDGYNSVKDWLLDIDYKKYLPKKDDHYLPKSYRLKPLNNVKLVSLERINWLET
                     IIG"
ORIGIN      
        1 atgtggataa catatcataa agatgatcca agaggagaat ataaacattt atcaccagaa
       61 acaaattata ccgtgggacg tgatgaaaat actgatataa aattctggtc acctaaagta
      121 tcaagagaat tgattgaatt aataactgga cccaacatag gcaataccca accaccatca
      181 tcgtcatcgt cttcttcttc aataggtagt gataaaacat tattaatcat tagaatatgt
      241 agtcgagcga aaacgattat aaatgggaaa acatataaat tattatcaaa agatagtaaa
      301 ccagaagaaa ttgatttcac aaatgaattc aaattgaaaa ttgaaactat tccacaaatt
      361 gataaacaaa caggacaaat aataactcaa gatactccat tgttcattga atggattccc
      421 tttaaattat atattagtgc aaatgagaaa tgtgatcaaa atcattacaa aacaataata
      481 aaagatcatg gtattgatat tcaaatcgtt gataatataa tggatgccac tcattattat
      541 tatgatagtg ataatggtaa caaccatatc aagctggaag aacaaaaaga tgaattcaaa
      601 ttggcaatta ttaagggtat cccaatttta aattcacaat ggttacaaaa agtattaggt
      661 catgataatg aggatgggta taatagtgtt aaggattggc ttttggatat agattataag
      721 aaatacttac caaaaaagga tgatcactat ttaccgaaaa gttatagatt aaagccatta
      781 aataatgtta aattagtatc attggagaga ataaattggt tggaaacaat aattgggtag