Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_019475443 456 bp mRNA linear PLN 18-APR-2022 partial mRNA. ACCESSION XM_019475443 VERSION XM_019475443.1 DBLINK BioProject: PRJNA14005 BioSample: SAMN02953594 KEYWORDS RefSeq. SOURCE Candida albicans SC5314 ORGANISM Candida albicans SC5314 Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade; Candida. REFERENCE 1 (bases 1 to 456) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Assembly of a phased diploid Candida albicans genome facilitates allele-specific measurements and provides a simple model for repeat and indel structure JOURNAL Genome Biol. 14 (9), R97 (2013) PUBMED 24025428 REFERENCE 2 (bases 1 to 456) AUTHORS van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D., Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B., Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T. TITLE Assembly of the Candida albicans genome into sixteen supercontigs aligned on the eight chromosomes JOURNAL Genome Biol. 8 (4), R52 (2007) PUBMED 17419877 REFERENCE 3 (bases 1 to 456) AUTHORS Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S., Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T., Davis,R.W. and Scherer,S. TITLE The diploid genome sequence of Candida albicans JOURNAL Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004) PUBMED 15123810 REFERENCE 4 (bases 1 to 456) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (15-APR-2022) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 5 (bases 1 to 456) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Direct Submission JOURNAL Submitted (04-OCT-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REFERENCE 6 (bases 1 to 456) CONSRTM Candida Genome Database TITLE Direct Submission JOURNAL Submitted (30-SEP-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REMARK Sequence and annotation update by submitter COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NC_032094). ##Genome-Annotation-Data-START## Annotation Provider :: CGD Annotation Status :: Full annotation Annotation Version :: A22-s07-m01-r01 URL :: http://www.candidagenome.org/ ##Genome-Annotation-Data-END## COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..456 /organism="Candida albicans SC5314" /mol_type="mRNA" /strain="SC5314" /host="Homo sapiens" /culture_collection="ATCC:MYA-2876" /db_xref="taxon:237561" /chromosome="6" /haplotype="A" /geo_loc_name="USA: New York" /collected_by="Margarita Silva-Hutner" gene <1..>456 /gene="RPS13" /locus_tag="CAALFM_C600650CA" /db_xref="GeneID:30515328" CDS 1..456 /gene="RPS13" /locus_tag="CAALFM_C600650CA" /note="Putative ribosomal protein of the small subunit" /codon_start=1 /transl_table=12 /product="ribosomal 40S subunit protein S13" /protein_id="XP_019330988.1" /db_xref="CGD:CAL0000187390" /db_xref="GeneID:30515328" /translation="MGRMHSSGKGISSSALPYSRNAPSWFKLSSDDVVEQIIKYARKG LTPSQIGVILRDAHGVSQAKVVTGNKILRILKSNGLAPEIPEDLYYLIKKAVSVRKHL EKNRKDKDSKFRLILIESRIHRLARYYRTVAVLPPNWKYESATASALVA" misc_feature 10..453 /gene="RPS13" /locus_tag="CAALFM_C600650CA" /note="40S ribosomal protein S13; Provisional; Region: PTZ00072" /db_xref="CDD:185427" ORIGIN 1 atgggtcgta tgcattcatc tggtaaaggt atttcctcct ccgctcttcc atactcaaga 61 aacgctccat cctggttcaa attgtcttct gacgatgttg ttgaacaaat catcaaatac 121 gccagaaaag gtttgactcc atctcaaatt ggtgttatct taagagatgc tcacggtgtt 181 tctcaagcca aggttgtcac tggtaacaag atcttgagaa tcttaaaatc taacggttta 241 gctccagaaa ttccagaaga tttatactac ttgatcaaga aagctgtctc tgtcagaaag 301 cacttggaaa aaaacagaaa agacaaagat tctaaattca gattaatttt gattgaatca 361 agaatccaca gattggctag atactacaga actgttgctg tcttaccacc aaactggaaa 421 tacgaatctg ctactgcctc tgctttagtt gcttaa