Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_019475441 261 bp mRNA linear PLN 18-APR-2022 partial mRNA. ACCESSION XM_019475441 VERSION XM_019475441.1 DBLINK BioProject: PRJNA14005 BioSample: SAMN02953594 KEYWORDS RefSeq. SOURCE Candida albicans SC5314 ORGANISM Candida albicans SC5314 Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade; Candida. REFERENCE 1 (bases 1 to 261) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Assembly of a phased diploid Candida albicans genome facilitates allele-specific measurements and provides a simple model for repeat and indel structure JOURNAL Genome Biol. 14 (9), R97 (2013) PUBMED 24025428 REFERENCE 2 (bases 1 to 261) AUTHORS van het Hoog,M., Rast,T.J., Martchenko,M., Grindle,S., Dignard,D., Hogues,H., Cuomo,C., Berriman,M., Scherer,S., Magee,B.B., Whiteway,M., Chibana,H., Nantel,A. and Magee,P.T. TITLE Assembly of the Candida albicans genome into sixteen supercontigs aligned on the eight chromosomes JOURNAL Genome Biol. 8 (4), R52 (2007) PUBMED 17419877 REFERENCE 3 (bases 1 to 261) AUTHORS Jones,T., Federspiel,N.A., Chibana,H., Dungan,J., Kalman,S., Magee,B.B., Newport,G., Thorstenson,Y.R., Agabian,N., Magee,P.T., Davis,R.W. and Scherer,S. TITLE The diploid genome sequence of Candida albicans JOURNAL Proc. Natl. Acad. Sci. U.S.A. 101 (19), 7329-7334 (2004) PUBMED 15123810 REFERENCE 4 (bases 1 to 261) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (15-APR-2022) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 5 (bases 1 to 261) AUTHORS Muzzey,D., Schwartz,K., Weissman,J.S. and Sherlock,G. TITLE Direct Submission JOURNAL Submitted (04-OCT-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REFERENCE 6 (bases 1 to 261) CONSRTM Candida Genome Database TITLE Direct Submission JOURNAL Submitted (30-SEP-2016) Department of Genetics, Candida Genome Database, Stanford University, Mail Stop-5120, Stanford, CA 94305, USA REMARK Sequence and annotation update by submitter COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NC_032094). ##Genome-Annotation-Data-START## Annotation Provider :: CGD Annotation Status :: Full annotation Annotation Version :: A22-s07-m01-r01 URL :: http://www.candidagenome.org/ ##Genome-Annotation-Data-END## COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..261 /organism="Candida albicans SC5314" /mol_type="mRNA" /strain="SC5314" /host="Homo sapiens" /culture_collection="ATCC:MYA-2876" /db_xref="taxon:237561" /chromosome="6" /haplotype="A" /geo_loc_name="USA: New York" /collected_by="Margarita Silva-Hutner" gene <1..>261 /locus_tag="CAALFM_C600530CA" /db_xref="GeneID:30515326" CDS 1..261 /locus_tag="CAALFM_C600530CA" /note="Ortholog(s) have role in mRNA splicing, via spliceosome and U1 snRNP, U2 snRNP, U2-type prespliceosome, U4/U6 x U5 tri-snRNP complex, U5 snRNP, cytosol localization" /codon_start=1 /transl_table=12 /product="mRNA splicing protein" /protein_id="XP_019330986.1" /db_xref="CGD:CAL0000200122" /db_xref="GeneID:30515326" /translation="MSSKQTKQTNLPPINLIFKFLQQSSVVTIWLYEQTQSRIQGKIR GFDEFMNIVIDDAVELSNGKKSELGRILLKGDNITLISSLDV" misc_feature 31..249 /locus_tag="CAALFM_C600530CA" /note="Sm protein E; Region: Sm_E; cd01718" /db_xref="CDD:212465" misc_feature order(58..60,94..96,100..102,109..111,130..141,151..153, 175..177,196..198,202..204,208..222,229..249) /locus_tag="CAALFM_C600530CA" /note="heptamer interface [polypeptide binding]; other site" /db_xref="CDD:212465" misc_feature order(85..105,109..147,151..165) /locus_tag="CAALFM_C600530CA" /note="Sm1 motif; other site" /db_xref="CDD:212465" misc_feature order(139..141,145..153,220..222,226..228) /locus_tag="CAALFM_C600530CA" /note="RNA binding site [nucleotide binding]; other site" /db_xref="CDD:212465" misc_feature 208..243 /locus_tag="CAALFM_C600530CA" /note="Sm2 motif; other site" /db_xref="CDD:212465" ORIGIN 1 atgtcatcaa aacaaactaa gcaaactaat cttcctccta tcaatcttat atttaagttt 61 ttacaacaac tgtcagtggt tactatatgg ttatacgagc aaacacaatc tagaattcaa 121 ggcaaaatca gaggatttga tgagtttatg aacattgtca ttgatgacgc agtggaattg 181 tcaaatggga aaaagtccga acttggtcga atactattga agggtgataa tattactttg 241 atttcaagct tggatgtata g