PREDICTED: Drosophila takahashii spheroide (sphe), mRNA.

LOCUS       XM_017160814            1354 bp    mRNA    linear   INV 09-DEC-2024
ACCESSION   XM_017160814
VERSION     XM_017160814.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017160814.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1354
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1354
                     /gene="sphe"
                     /note="spheroide; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 1 Protein"
                     /db_xref="GeneID:108070369"
     CDS             540..1289
                     /gene="sphe"
                     /codon_start=1
                     /product="chymotrypsin-1"
                     /protein_id="XP_017016303.2"
                     /db_xref="GeneID:108070369"
                     /translation="MMQQRSLILALICLTLVGVCHARGRIMGGEEADPTATPYAASLR
                     VDNAHVCGGCILSETKILTTAHCVHREGNLIDASRLSCRVGSTNQYAGGRIVTVESVT
                     VHPDYYQLTNNLAVITLSSPLVYTDRIKAIAVADAGEALPAEGSEVAVAGWGRTAEGT
                     TSYKIREMSLTVAQESACQDAYSEHSEQSFCLAHELKEGTCHGDGGSGAVYGDKLIGL
                     TNFVVGACGSRYPDVFVRLSSFSDWIQEQIA"
     misc_feature    615..1280
                     /gene="sphe"
                     /note="Trypsin-like serine protease; Many of these are
                     synthesized as inactive precursor zymogens that are
                     cleaved during limited proteolysis to generate their
                     active forms. Alignment contains also inactive enzymes
                     that have substitutions of the catalytic triad...; Region:
                     Tryp_SPc; cd00190"
                     /db_xref="CDD:238113"
     misc_feature    615..617
                     /gene="sphe"
                     /note="cleavage site [active]"
                     /db_xref="CDD:238113"
     misc_feature    order(735..737,876..878,1152..1154)
                     /gene="sphe"
                     /note="active site"
                     /db_xref="CDD:238113"
     misc_feature    order(1134..1136,1197..1199,1203..1205)
                     /gene="sphe"
                     /note="substrate binding sites [chemical binding]; other
                     site"
                     /db_xref="CDD:238113"
     polyA_site      1354
                     /gene="sphe"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tactgcagaa aatttagaat atgttagaat ttaattttgg tttatttgag atatgaaaag
       61 ttgtttatta aatattaata taactaaaaa gtaactatgg taaatattca aggtatttct
      121 gaatccaccc tcttttaata tctgccaaaa ctaccctata tattttttta aaatcccctg
      181 actcacggat tactcatctt tatctacctc agatgggtgt tgtgttgtct tgtcatggtc
      241 actggatcgt ttggacttcc ctccgccgcc atgtgcaatt ttctatttat gtgccaattg
      301 atcggtgaaa caacaagtaa caatagtcta tgggcattat aaacggggcg ataagattag
      361 atttagtgtg atgcccgaaa ggcaaggaaa gataaggatt ggccaagaag ggagggacgg
      421 tggttcgatg gagtcgtcca cttaaattgt agccgctggc attgcgcatt tccagtccaa
      481 ccgtcgtggg cgactgaacc accaaattaa gaataaataa caaaagaaga aaccccgaaa
      541 tgatgcagca gagatccctg attttggccc tcatttgcct gaccctcgtg ggcgtctgcc
      601 acgcccgcgg acgcattatg ggcggcgagg aggcggaccc cacggccacg ccctacgccg
      661 cctccctgcg cgtggacaac gcccacgtgt gcggcggctg cattctctcc gagaccaaga
      721 tcctgaccac cgcccactgt gtccatcgcg agggaaatct catcgatgcc agtcgccttt
      781 cgtgccgagt gggcagcacc aatcagtatg ccggcggcag gattgtgacc gtggaatccg
      841 taaccgttca tcccgactac tatcagctga ccaacaacct ggccgtgatc acgctgagca
      901 gcccgctggt ctacacggat cgcatcaagg ccattgcggt ggccgacgcg ggagaggcgc
      961 tgcccgccga gggttcggag gtcgcggtgg ccggctgggg tcgcaccgcc gagggcacca
     1021 cgtcctacaa gatccgtgaa atgtcgctga cggtggccca ggagtccgcc tgccaggatg
     1081 cctacagcga gcacagcgag cagagcttct gcctggccca cgaactcaag gagggcacct
     1141 gccacggcga cggaggcagt ggcgccgtct acggggacaa gctaattggt ttgaccaact
     1201 ttgtggtcgg cgcctgtgga tcccgctacc ccgatgtctt cgtgcgcctc tccagcttca
     1261 gcgattggat ccaggagcag atcgcttaag gaacctaacc cctgagcacg tcccttaaaa
     1321 attaaaatac ttagttattt cccaaaaaac caaa