Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii leg arista wing complex (lawc),


LOCUS       XM_017160803             657 bp    mRNA    linear   INV 09-DEC-2024
            mRNA.
ACCESSION   XM_017160803
VERSION     XM_017160803.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq; corrected model.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017160803.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            frameshifts :: corrected 1 indel
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-314               JARPSC010000001.1  7527793-7528106     c
            315-518             JARPSC010000001.1  7527587-7527790     c
            519-657             JARPSC010000001.1  7526526-7526664     c
FEATURES             Location/Qualifiers
     source          1..657
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..657
                     /gene="lawc"
                     /note="leg arista wing complex; The sequence of the model
                     RefSeq transcript was modified relative to its source
                     genomic sequence to represent the inferred CDS: deleted 2
                     bases in 1 codon; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 1 Protein"
                     /db_xref="GeneID:108070361"
     CDS             270..572
                     /gene="lawc"
                     /note="The sequence of the model RefSeq protein was
                     modified relative to its source genomic sequence to
                     represent the inferred CDS: deleted 2 bases in 1 codon"
                     /codon_start=1
                     /product="LOW QUALITY PROTEIN: uncharacterized protein
                     lawc"
                     /protein_id="XP_017016292.3"
                     /db_xref="GeneID:108070361"
                     /translation="MLSPPHTRFLPLCGAARVLSQQQTRNKSSKTVEVYRDASKNLSF
                     DVVAVRCSSCCCCCVPRISCAFIYICTHIYMCTYMTSQELLTSLNPTNAIRSLRFV"
ORIGIN      
        1 actggacaaa aagggggggt cgttaatttg gagcaagcaa gcgcgcaggc ggcgaattgg
       61 cggcgcgagc gtgacgagcg aaacgaaacg cggcgaacgg ccgaatcact gtggcattgg
      121 caatggcagc gcttgtcgct tcagtgtgtg cgtcgcgata aacgcgagcg aaacgggcgg
      181 cgctgctgaa cgcgcaccga ccacgaccac aaccacacac gcacaccacc gcacaccgtc
      241 gctcgtacgt atacggggcg agagagcgca tgctctcacc gccacacacg cgttttctcc
      301 cgctttgtgg cgccgcgcga gttttgtcgc agcagcaaac acgcaataaa agttcaaaaa
      361 cagttgaagt ataccgcgac gcgagtaaaa atctttcctt cgacgtcgtc gctgttcgtt
      421 gtagtagttg ttgttgttgc tgtgttccgc gaatttcatg tgcattcatc tatatatgta
      481 cacatatata tatgtgtaca tatatgacaa gccaagagct cctcacttca ttaaatccaa
      541 caaatgctat ccgttcgctc cgatttgttt gagaacaacc cgcaaatgga ctacagcgat
      601 atgaacttca agtttcaagt gggctcgcgc cagggctcac gactaatcgc ctgcgag