Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017160803 657 bp mRNA linear INV 09-DEC-2024 mRNA. ACCESSION XM_017160803 VERSION XM_017160803.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq; corrected model. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017160803.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## frameshifts :: corrected 1 indel ##RefSeq-Attributes-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-314 JARPSC010000001.1 7527793-7528106 c 315-518 JARPSC010000001.1 7527587-7527790 c 519-657 JARPSC010000001.1 7526526-7526664 c FEATURES Location/Qualifiers source 1..657 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..657 /gene="lawc" /note="leg arista wing complex; The sequence of the model RefSeq transcript was modified relative to its source genomic sequence to represent the inferred CDS: deleted 2 bases in 1 codon; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108070361" CDS 270..572 /gene="lawc" /note="The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: deleted 2 bases in 1 codon" /codon_start=1 /product="LOW QUALITY PROTEIN: uncharacterized protein lawc" /protein_id="XP_017016292.3" /db_xref="GeneID:108070361" /translation="MLSPPHTRFLPLCGAARVLSQQQTRNKSSKTVEVYRDASKNLSF DVVAVRCSSCCCCCVPRISCAFIYICTHIYMCTYMTSQELLTSLNPTNAIRSLRFV" ORIGIN 1 actggacaaa aagggggggt cgttaatttg gagcaagcaa gcgcgcaggc ggcgaattgg 61 cggcgcgagc gtgacgagcg aaacgaaacg cggcgaacgg ccgaatcact gtggcattgg 121 caatggcagc gcttgtcgct tcagtgtgtg cgtcgcgata aacgcgagcg aaacgggcgg 181 cgctgctgaa cgcgcaccga ccacgaccac aaccacacac gcacaccacc gcacaccgtc 241 gctcgtacgt atacggggcg agagagcgca tgctctcacc gccacacacg cgttttctcc 301 cgctttgtgg cgccgcgcga gttttgtcgc agcagcaaac acgcaataaa agttcaaaaa 361 cagttgaagt ataccgcgac gcgagtaaaa atctttcctt cgacgtcgtc gctgttcgtt 421 gtagtagttg ttgttgttgc tgtgttccgc gaatttcatg tgcattcatc tatatatgta 481 cacatatata tatgtgtaca tatatgacaa gccaagagct cctcacttca ttaaatccaa 541 caaatgctat ccgttcgctc cgatttgttt gagaacaacc cgcaaatgga ctacagcgat 601 atgaacttca agtttcaagt gggctcgcgc cagggctcac gactaatcgc ctgcgag