Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017160801 1048 bp mRNA linear INV 09-DEC-2024 sing (sing), mRNA. ACCESSION XM_017160801 VERSION XM_017160801.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017160801.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1048 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1048 /gene="sing" /note="MARVEL domain-containing protein sing; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins" /db_xref="GeneID:108070360" CDS 457..987 /gene="sing" /codon_start=1 /product="protein singles bar" /protein_id="XP_017016290.1" /db_xref="GeneID:108070360" /translation="MASFGVRGMAQPLGIRICCCRVCTCINFGFVLSRIGLLKLMELG LAMLCEGLLIKYGIPYGDSIGQALTSFLATTGHCSTTTGILLLCYAFSDKSYSLIRQS MFETLFNALASCMYFSSASYMGFACVVWLHPQFLVRPGFWAYPAMTACYYMGYAAGIL HALDAYLAFRHFRGSR" misc_feature 544..957 /gene="sing" /note="Membrane-associating domain; Region: MARVEL; pfam01284" /db_xref="CDD:366555" ORIGIN 1 caaggtgggg gaagatcgtc tcgaatgggg atggggacat gatttatcga tttgccgata 61 gcggatagct gataagcagc atagaacacg accccttggg agacacgaga aaagaatttg 121 cggtacatgt atgtagaatg tacatacatg gcggcttacc gcatgtaagt aagggttgcc 181 catcacagca gcggctaaaa tgtgaaatta atttttatgg tgttgcatgc aaagtggttt 241 aattttaaat actgttggta ttaaataatt attattataa atccattata acagactgtg 301 aaggatttgg tgcgaagatc agaacactcg aaatgcaagg aaatgcgccg cttggggccc 361 acatgtcttg ggagttattt atagaaaccc aaactcatcc atcgggcgga caacaaagcg 421 gagtcccagc ctcacgagat catttgccat cagaccatgg cctcgttcgg agttcgggga 481 atggcccagc cgctgggcat ccgcatctgc tgctgccgcg tctgcacctg catcaacttc 541 ggattcgttc tgtcccggat cgggctcctc aagctgatgg aactgggcct ggccatgctg 601 tgcgagggcc tgctgatcaa gtatggcatt ccgtatggcg actccattgg ccaggcgctg 661 accagcttcc tggccaccac gggccactgc tccaccacca ccggcatcct gctgctgtgc 721 tacgcgttct ccgacaaatc ctacagcctc atccgccagt cgatgtttga gaccttgttc 781 aacgccttag ccagttgcat gtacttcagt tcagccagtt acatgggttt cgcctgtgtg 841 gtctggctgc atccgcagtt tctcgtgcgt cccggattct gggcttatcc cgccatgacg 901 gcctgctatt acatgggcta tgcggcgggc attttgcatg ccctggatgc ctacctggca 961 ttccggcact ttcgcggctc acgctaggat cccttggcca tataaaagag cagtatctca 1021 agtaatttgt ggacatattt atatgagt