Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii MARVEL domain-containing protein


LOCUS       XM_017160801            1048 bp    mRNA    linear   INV 09-DEC-2024
            sing (sing), mRNA.
ACCESSION   XM_017160801
VERSION     XM_017160801.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017160801.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1048
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1048
                     /gene="sing"
                     /note="MARVEL domain-containing protein sing; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 3 Proteins"
                     /db_xref="GeneID:108070360"
     CDS             457..987
                     /gene="sing"
                     /codon_start=1
                     /product="protein singles bar"
                     /protein_id="XP_017016290.1"
                     /db_xref="GeneID:108070360"
                     /translation="MASFGVRGMAQPLGIRICCCRVCTCINFGFVLSRIGLLKLMELG
                     LAMLCEGLLIKYGIPYGDSIGQALTSFLATTGHCSTTTGILLLCYAFSDKSYSLIRQS
                     MFETLFNALASCMYFSSASYMGFACVVWLHPQFLVRPGFWAYPAMTACYYMGYAAGIL
                     HALDAYLAFRHFRGSR"
     misc_feature    544..957
                     /gene="sing"
                     /note="Membrane-associating domain; Region: MARVEL;
                     pfam01284"
                     /db_xref="CDD:366555"
ORIGIN      
        1 caaggtgggg gaagatcgtc tcgaatgggg atggggacat gatttatcga tttgccgata
       61 gcggatagct gataagcagc atagaacacg accccttggg agacacgaga aaagaatttg
      121 cggtacatgt atgtagaatg tacatacatg gcggcttacc gcatgtaagt aagggttgcc
      181 catcacagca gcggctaaaa tgtgaaatta atttttatgg tgttgcatgc aaagtggttt
      241 aattttaaat actgttggta ttaaataatt attattataa atccattata acagactgtg
      301 aaggatttgg tgcgaagatc agaacactcg aaatgcaagg aaatgcgccg cttggggccc
      361 acatgtcttg ggagttattt atagaaaccc aaactcatcc atcgggcgga caacaaagcg
      421 gagtcccagc ctcacgagat catttgccat cagaccatgg cctcgttcgg agttcgggga
      481 atggcccagc cgctgggcat ccgcatctgc tgctgccgcg tctgcacctg catcaacttc
      541 ggattcgttc tgtcccggat cgggctcctc aagctgatgg aactgggcct ggccatgctg
      601 tgcgagggcc tgctgatcaa gtatggcatt ccgtatggcg actccattgg ccaggcgctg
      661 accagcttcc tggccaccac gggccactgc tccaccacca ccggcatcct gctgctgtgc
      721 tacgcgttct ccgacaaatc ctacagcctc atccgccagt cgatgtttga gaccttgttc
      781 aacgccttag ccagttgcat gtacttcagt tcagccagtt acatgggttt cgcctgtgtg
      841 gtctggctgc atccgcagtt tctcgtgcgt cccggattct gggcttatcc cgccatgacg
      901 gcctgctatt acatgggcta tgcggcgggc attttgcatg ccctggatgc ctacctggca
      961 ttccggcact ttcgcggctc acgctaggat cccttggcca tataaaagag cagtatctca
     1021 agtaatttgt ggacatattt atatgagt