PREDICTED: Drosophila takahashii serine protease SP24D

LOCUS       XM_017160785            1023 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108070347), mRNA.
ACCESSION   XM_017160785
VERSION     XM_017160785.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017160785.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1023
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1023
                     /gene="LOC108070347"
                     /note="serine protease SP24D; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 4
                     Proteins"
                     /db_xref="GeneID:108070347"
     CDS             22..789
                     /gene="LOC108070347"
                     /codon_start=1
                     /product="serine protease SP24D"
                     /protein_id="XP_017016274.3"
                     /db_xref="GeneID:108070347"
                     /translation="MLPLWTTFLLLLCTAGVLGKKGNDSDVVEPRIVGGTRAKEGQFP
                     HQISLRRRGGHTCGGSILSNDYVVTAAHCVKQGNDVAPANQLSIQAGSLLLSSGGVNI
                     PVATVTVHPNYRGNGYDVAVLRLSRSLTFDSNIAAIQLATDDPPNDATVDISGWGAIS
                     QKGPLSNSLLYVQVKALSRDTCQRRYLRGLPETTMCLMHPANKGACYGDSGGPATYGG
                     KLVGLASFVIGGCGRDAPDGYERVSQLRTWIREKAGL"
     misc_feature    115..777
                     /gene="LOC108070347"
                     /note="Trypsin-like serine protease; Many of these are
                     synthesized as inactive precursor zymogens that are
                     cleaved during limited proteolysis to generate their
                     active forms. Alignment contains also inactive enzymes
                     that have substitutions of the catalytic triad...; Region:
                     Tryp_SPc; cd00190"
                     /db_xref="CDD:238113"
     misc_feature    115..117
                     /gene="LOC108070347"
                     /note="cleavage site [active]"
                     /db_xref="CDD:238113"
     misc_feature    order(235..237,376..378,649..651)
                     /gene="LOC108070347"
                     /note="active site"
                     /db_xref="CDD:238113"
     misc_feature    order(631..633,694..696,700..702)
                     /gene="LOC108070347"
                     /note="substrate binding sites [chemical binding]; other
                     site"
                     /db_xref="CDD:238113"
     polyA_site      1023
                     /gene="LOC108070347"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 gggaagtaca atctaccagt catgttacct ctttggacca cttttctact gctgctctgc
       61 actgccggag ttctgggcaa aaaaggcaac gattccgatg tggtggagcc ccggattgtg
      121 ggcggaaccc gggcgaagga gggtcaattt ccccaccaga tttccctgcg ccgtcgcgga
      181 ggtcacactt gcggtggctc catattgtcc aacgattatg tggtcaccgc ggcccattgc
      241 gtgaagcagg gcaacgatgt agccccagcc aaccagctgt ccatccaggc gggcagcttg
      301 ctcctttcaa gcggaggagt caacattcca gtggccactg ttaccgtgca tccgaattac
      361 aggggcaacg gctacgatgt ggccgtgctg cggctctcca gatccctgac cttcgactcc
      421 aacatcgccg ccattcagct ggccaccgat gatccgccca acgatgccac cgtggacatc
      481 tccggctggg gagccatctc ccaaaaggga ccgctctcga attcgctgct ctacgtccag
      541 gtgaaggccc tgtcgcggga cacctgccag cggaggtacc tccgaggact gccggagacg
      601 acaatgtgcc tgatgcatcc ggcgaacaag ggcgcctgct acggcgactc cggcggaccg
      661 gccacctacg gaggcaaact ggtcggcctg gccagcttcg tgatcggcgg ctgtggacga
      721 gatgcccccg atggctacga gagggtctcc cagctgagga cttggatcag ggagaaggcc
      781 ggtttgtagg atcccaaaaa cgtccttatg caagtcaatt gaaaattggt gtttcttctt
      841 ggtccctaac tatttcaaaa atgatctacc aattttttct ttgattttcg cctaaaaata
      901 actatttttt ttatatacca cgtgtaattt gtttgcgatt taaattcatt tttataacgc
      961 agcgaagtac tatattatat cgagcacttg aaatattaaa taataaaaag cagcacagca
     1021 aaa