Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017160766 434 bp mRNA linear INV 09-DEC-2024 transcript variant X1, mRNA. ACCESSION XM_017160766 VERSION XM_017160766.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017160766.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..434 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..434 /gene="LOC108070335" /note="cytochrome b5; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 Proteins" /db_xref="GeneID:108070335" CDS 94..414 /gene="LOC108070335" /codon_start=1 /product="cytochrome b5 isoform X1" /protein_id="XP_017016255.1" /db_xref="GeneID:108070335" /translation="MSKEIYLATVKQHNTAKDLWIVIDNKVYDVTKFRLEHPGGEDSL VDVAGRDATKDFNDVGHSSEAREMLKKYYIGDLAAADRVKKSPISATPTTEAAAPKQC CILN" misc_feature 112..327 /gene="LOC108070335" /note="Cytochrome b5-like Heme/Steroid binding domain; Region: Cyt-b5; pfam00173" /db_xref="CDD:459698" ORIGIN 1 gtcacacttg aggtcagagc acttttttcc gagcacaaca ggttcgcagt tgtttttttt 61 ttgtgtgaac gaggagaaca ggaggcagct aggatgagca aggaaatcta tttggccacc 121 gtgaagcagc acaacacggc caaggacctg tggatagtca tcgacaacaa ggtgtacgat 181 gtgacgaagt tccggctaga gcatcccggt ggcgaggact ccctggtgga tgtggccggt 241 cgcgatgcca ccaaggactt taacgacgtg ggtcacagct cggaggcgag ggagatgctg 301 aagaagtact acattggcga cctggccgct gctgatagag tcaagaagag tccaattagt 361 gccacgccca ccacagaagc cgccgccccc aagcaatgct gcatcttaaa ttaaccccta 421 ttaatccgaa aaac