Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii cytochrome b5 (LOC108070335),


LOCUS       XM_017160766             434 bp    mRNA    linear   INV 09-DEC-2024
            transcript variant X1, mRNA.
ACCESSION   XM_017160766
VERSION     XM_017160766.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017160766.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..434
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..434
                     /gene="LOC108070335"
                     /note="cytochrome b5; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 4 Proteins"
                     /db_xref="GeneID:108070335"
     CDS             94..414
                     /gene="LOC108070335"
                     /codon_start=1
                     /product="cytochrome b5 isoform X1"
                     /protein_id="XP_017016255.1"
                     /db_xref="GeneID:108070335"
                     /translation="MSKEIYLATVKQHNTAKDLWIVIDNKVYDVTKFRLEHPGGEDSL
                     VDVAGRDATKDFNDVGHSSEAREMLKKYYIGDLAAADRVKKSPISATPTTEAAAPKQC
                     CILN"
     misc_feature    112..327
                     /gene="LOC108070335"
                     /note="Cytochrome b5-like Heme/Steroid binding domain;
                     Region: Cyt-b5; pfam00173"
                     /db_xref="CDD:459698"
ORIGIN      
        1 gtcacacttg aggtcagagc acttttttcc gagcacaaca ggttcgcagt tgtttttttt
       61 ttgtgtgaac gaggagaaca ggaggcagct aggatgagca aggaaatcta tttggccacc
      121 gtgaagcagc acaacacggc caaggacctg tggatagtca tcgacaacaa ggtgtacgat
      181 gtgacgaagt tccggctaga gcatcccggt ggcgaggact ccctggtgga tgtggccggt
      241 cgcgatgcca ccaaggactt taacgacgtg ggtcacagct cggaggcgag ggagatgctg
      301 aagaagtact acattggcga cctggccgct gctgatagag tcaagaagag tccaattagt
      361 gccacgccca ccacagaagc cgccgccccc aagcaatgct gcatcttaaa ttaaccccta
      421 ttaatccgaa aaac