Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017160752 885 bp mRNA linear INV 09-DEC-2024 mRNA. ACCESSION XM_017160752 VERSION XM_017160752.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017160752.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..885 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..885 /gene="Josd" /note="Josephin domain containing; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:108070329" CDS 156..827 /gene="Josd" /codon_start=1 /product="josephin-like protein" /protein_id="XP_017016241.2" /db_xref="GeneID:108070329" /translation="MENPSSGTLANKNPNNGNGNGNGTMMQQGNQESSIYHERQTRHL CGLHALNNLFQSPDMFSKSELDHYCTTLTPRNWLNPHRSWIGWGNYDVNVIMYALQQR NCEAVWFDRRRDPHCLNLKAIFGFILNVPAQMNLGYYIQLPFQMRHWLALRRIDGSYY NLDSKLREPRCLGDEESFLAFLSSHLQTDHELFLVLNEEEQMQQKQQQEKDSKQRWLL PQFRD" misc_feature 273..695 /gene="Josd" /note="Region: Josephin; pfam02099" /db_xref="CDD:460444" polyA_site 885 /gene="Josd" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 actagtttgc catcgctatt gccttgccat ccctaaaagc aaaatcgagt cctaagtttt 61 ttgtaaacaa aaaggcaaat tattaaatct agtgacattt cccagctgcc cagctcaatc 121 agttactgga atctgtcagc ctatacagct gcgaaatgga aaatcccagt tctgggacac 181 tggcaaacaa gaacccaaac aacggaaatg gaaatggaaa cggcacaatg atgcagcagg 241 gaaaccagga atcctccatc taccacgaga gacagactcg gcatttgtgc ggcctgcacg 301 ccttgaacaa cctgttccag agccccgaca tgttctccaa gtcggaactg gaccactact 361 gcaccacact gaccccgcgc aactggctga atccgcatcg ctcgtggatc ggctggggca 421 actacgatgt gaatgtgatt atgtacgcct tgcagcagcg gaattgcgag gctgtgtggt 481 tcgatcgccg acgggatccc cattgcctca atctcaaggc catctttggg ttcatcctga 541 acgtgccggc acaaatgaac ctcggctact acatccaatt gcccttccag atgcgccact 601 ggctggccct gcgtcgcatc gatggcagct actacaatct ggactccaag ctgcgggagc 661 cccgttgcct cggcgacgag gagagcttcc tcgcgttcct ctccagccat ctgcagacgg 721 accacgagct gttcctggtc ctcaacgagg aggagcagat gcagcagaag cagcagcagg 781 agaaggactc caagcagcgt tggctgctgc cgcagttcag ggattaagat tataggttat 841 atggttatgg ttatggcaat aaaatgtaca ctgtgcaact aacaa