Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii Josephin domain containing (Josd),


LOCUS       XM_017160752             885 bp    mRNA    linear   INV 09-DEC-2024
            mRNA.
ACCESSION   XM_017160752
VERSION     XM_017160752.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017160752.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..885
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..885
                     /gene="Josd"
                     /note="Josephin domain containing; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 2
                     Proteins"
                     /db_xref="GeneID:108070329"
     CDS             156..827
                     /gene="Josd"
                     /codon_start=1
                     /product="josephin-like protein"
                     /protein_id="XP_017016241.2"
                     /db_xref="GeneID:108070329"
                     /translation="MENPSSGTLANKNPNNGNGNGNGTMMQQGNQESSIYHERQTRHL
                     CGLHALNNLFQSPDMFSKSELDHYCTTLTPRNWLNPHRSWIGWGNYDVNVIMYALQQR
                     NCEAVWFDRRRDPHCLNLKAIFGFILNVPAQMNLGYYIQLPFQMRHWLALRRIDGSYY
                     NLDSKLREPRCLGDEESFLAFLSSHLQTDHELFLVLNEEEQMQQKQQQEKDSKQRWLL
                     PQFRD"
     misc_feature    273..695
                     /gene="Josd"
                     /note="Region: Josephin; pfam02099"
                     /db_xref="CDD:460444"
     polyA_site      885
                     /gene="Josd"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 actagtttgc catcgctatt gccttgccat ccctaaaagc aaaatcgagt cctaagtttt
       61 ttgtaaacaa aaaggcaaat tattaaatct agtgacattt cccagctgcc cagctcaatc
      121 agttactgga atctgtcagc ctatacagct gcgaaatgga aaatcccagt tctgggacac
      181 tggcaaacaa gaacccaaac aacggaaatg gaaatggaaa cggcacaatg atgcagcagg
      241 gaaaccagga atcctccatc taccacgaga gacagactcg gcatttgtgc ggcctgcacg
      301 ccttgaacaa cctgttccag agccccgaca tgttctccaa gtcggaactg gaccactact
      361 gcaccacact gaccccgcgc aactggctga atccgcatcg ctcgtggatc ggctggggca
      421 actacgatgt gaatgtgatt atgtacgcct tgcagcagcg gaattgcgag gctgtgtggt
      481 tcgatcgccg acgggatccc cattgcctca atctcaaggc catctttggg ttcatcctga
      541 acgtgccggc acaaatgaac ctcggctact acatccaatt gcccttccag atgcgccact
      601 ggctggccct gcgtcgcatc gatggcagct actacaatct ggactccaag ctgcgggagc
      661 cccgttgcct cggcgacgag gagagcttcc tcgcgttcct ctccagccat ctgcagacgg
      721 accacgagct gttcctggtc ctcaacgagg aggagcagat gcagcagaag cagcagcagg
      781 agaaggactc caagcagcgt tggctgctgc cgcagttcag ggattaagat tataggttat
      841 atggttatgg ttatggcaat aaaatgtaca ctgtgcaact aacaa