Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii uncharacterized protein


LOCUS       XM_017160723            1100 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108070303), transcript variant X1, mRNA.
ACCESSION   XM_017160723
VERSION     XM_017160723.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017160723.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1100
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1100
                     /gene="LOC108070303"
                     /note="uncharacterized LOC108070303; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:108070303"
     CDS             232..927
                     /gene="LOC108070303"
                     /codon_start=1
                     /product="uncharacterized protein isoform X1"
                     /protein_id="XP_017016212.2"
                     /db_xref="GeneID:108070303"
                     /translation="MKFYLLVIAAVAFLTYISGGLAKTQSKRSVPLAQFADGCIQCNS
                     KDNERCATDPLSLLNRNCSDGTSNCYSRVLNGNTIRGCAVDLDNATRNSCNSEMECQL
                     CTYTEGCNRNTFPLSRLQCLQCSGNSTSSPCAAETYASAKICPIYKFGDKCYIRNSNR
                     TVDGSFQRGCLSSATAKKQCVKEENCYICDGRACNFLHSNDTNIPLARDSGAQLALSV
                     SLMVGGLLAAWRL"
     misc_feature    355..798
                     /gene="LOC108070303"
                     /note="Protein of unknown function (DUF753); Region:
                     DUF753; pfam05444"
                     /db_xref="CDD:461654"
     polyA_site      1100
                     /gene="LOC108070303"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ctgtgaatca ctggccataa ctttggttcg gccaccatat cagtttcgat tacggctgtc
       61 ggggggcctt atctctttct acgagctttc cgagcctcaa atccccatac gaaccgtgga
      121 tactcccgtc agtctttatt cagctctact gcccgtcgct tcatcgatcg ccgtgaaatt
      181 agcaattgat ttaaccacat tcgttcgaga tcgaatatcc agagagtcat tatgaagttc
      241 tacttgttgg tgatcgctgc cgtggcgttt ctgacctaca tcagtggtgg cttggccaag
      301 actcaatcga aacgctccgt tcccctcgct caattcgcag atggctgcat ccagtgcaac
      361 tccaaggaca acgaacgctg cgccaccgat ccgctgagcc tgctaaaccg caactgctcc
      421 gatggaacct ccaactgcta ctcccgcgtc ctgaatggca acacgatccg tggctgtgcc
      481 gttgacctgg acaacgccac ccggaactcg tgcaacagcg agatggagtg ccagttgtgc
      541 acctacacgg agggctgcaa ccgcaacacc ttcccgctga gccggctgca gtgcctccag
      601 tgcagcggca actcgacgtc ctcgccctgc gccgcggaga cctacgcgtc ggcgaagatc
      661 tgcccgatct acaagttcgg cgacaagtgc tacatccgca acagcaaccg caccgtggac
      721 gggtccttcc agcgcggctg cctctcctcg gccaccgcca agaagcagtg cgtcaaggag
      781 gagaactgct acatctgcga tggtcgcgcc tgcaacttcc tccactccaa cgacaccaac
      841 attccgctgg cccgcgactc cggcgcccag ttggctctgt ccgtgtccct gatggtcggc
      901 ggactcctgg ccgcctggag gctctaagga gccgctctag ggacaatgga tgaaagccaa
      961 tcctcccacc tttccctact gcctgggctc catcttctga atcatccttt tctttccgca
     1021 gcattataat tgatatgtat atcattttct tctttttttt ttgccttgaa caaaaataaa
     1081 aataaatcta caagtaacaa