Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017160723 1100 bp mRNA linear INV 09-DEC-2024 (LOC108070303), transcript variant X1, mRNA. ACCESSION XM_017160723 VERSION XM_017160723.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017160723.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1100 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1100 /gene="LOC108070303" /note="uncharacterized LOC108070303; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108070303" CDS 232..927 /gene="LOC108070303" /codon_start=1 /product="uncharacterized protein isoform X1" /protein_id="XP_017016212.2" /db_xref="GeneID:108070303" /translation="MKFYLLVIAAVAFLTYISGGLAKTQSKRSVPLAQFADGCIQCNS KDNERCATDPLSLLNRNCSDGTSNCYSRVLNGNTIRGCAVDLDNATRNSCNSEMECQL CTYTEGCNRNTFPLSRLQCLQCSGNSTSSPCAAETYASAKICPIYKFGDKCYIRNSNR TVDGSFQRGCLSSATAKKQCVKEENCYICDGRACNFLHSNDTNIPLARDSGAQLALSV SLMVGGLLAAWRL" misc_feature 355..798 /gene="LOC108070303" /note="Protein of unknown function (DUF753); Region: DUF753; pfam05444" /db_xref="CDD:461654" polyA_site 1100 /gene="LOC108070303" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 ctgtgaatca ctggccataa ctttggttcg gccaccatat cagtttcgat tacggctgtc 61 ggggggcctt atctctttct acgagctttc cgagcctcaa atccccatac gaaccgtgga 121 tactcccgtc agtctttatt cagctctact gcccgtcgct tcatcgatcg ccgtgaaatt 181 agcaattgat ttaaccacat tcgttcgaga tcgaatatcc agagagtcat tatgaagttc 241 tacttgttgg tgatcgctgc cgtggcgttt ctgacctaca tcagtggtgg cttggccaag 301 actcaatcga aacgctccgt tcccctcgct caattcgcag atggctgcat ccagtgcaac 361 tccaaggaca acgaacgctg cgccaccgat ccgctgagcc tgctaaaccg caactgctcc 421 gatggaacct ccaactgcta ctcccgcgtc ctgaatggca acacgatccg tggctgtgcc 481 gttgacctgg acaacgccac ccggaactcg tgcaacagcg agatggagtg ccagttgtgc 541 acctacacgg agggctgcaa ccgcaacacc ttcccgctga gccggctgca gtgcctccag 601 tgcagcggca actcgacgtc ctcgccctgc gccgcggaga cctacgcgtc ggcgaagatc 661 tgcccgatct acaagttcgg cgacaagtgc tacatccgca acagcaaccg caccgtggac 721 gggtccttcc agcgcggctg cctctcctcg gccaccgcca agaagcagtg cgtcaaggag 781 gagaactgct acatctgcga tggtcgcgcc tgcaacttcc tccactccaa cgacaccaac 841 attccgctgg cccgcgactc cggcgcccag ttggctctgt ccgtgtccct gatggtcggc 901 ggactcctgg ccgcctggag gctctaagga gccgctctag ggacaatgga tgaaagccaa 961 tcctcccacc tttccctact gcctgggctc catcttctga atcatccttt tctttccgca 1021 gcattataat tgatatgtat atcattttct tctttttttt ttgccttgaa caaaaataaa 1081 aataaatcta caagtaacaa