Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii BthD selenoprotein (BthD), mRNA.


LOCUS       XM_017160599             930 bp    mRNA    linear   INV 09-DEC-2024
ACCESSION   XM_017160599
VERSION     XM_017160599.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017160599.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..930
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..930
                     /gene="BthD"
                     /note="BthD selenoprotein; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 4
                     Proteins"
                     /db_xref="GeneID:108070212"
     CDS             94..750
                     /gene="BthD"
                     /codon_start=1
                     /transl_except=(pos:202..204,aa:Sec)
                     /product="selenoprotein BthD"
                     /protein_id="XP_017016088.2"
                     /db_xref="GeneID:108070212"
                     /translation="MPPKRAKKAAEPAAREDEAAELDPNEPVLHVEHCRSURVFRRRA
                     KDLHSALRERGLRRLQLRLNASGAPRRGAFELALQPGLGSGLGEQQKQQEQVPLWSGL
                     KRGPPRALKFPTVEEVYDRIQAILGVDLQGNKTESTEKPLPKDLPNEEAQKDQESKEL
                     PEQEPKKLTKAKRQPKAPKKPTKSPEEMDKEPPQSSQKRKRTTRSSTEEASTSAKRRK
                     "
     polyA_site      930
                     /gene="BthD"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 taatagcaag ggcattcctt cgttatttca ccatctggca acgctgtaaa ttaaaggcgc
       61 aaattgtctt aaaaattcca aaccaaactt aagatgccac caaaaagggc caaaaaagcg
      121 gcggagccag ccgctcggga ggatgaagcc gcagaactgg atcccaacga accggtgctc
      181 catgtggagc actgtcgttc ctgacgcgtc tttcgtcgtc gggcgaagga tctgcactct
      241 gctctgcggg aacgcggtct ccgtcgcctt cagctgcgac tgaatgcatc cggagcaccg
      301 cggcgaggcg ccttcgagtt ggccttgcag ccgggattgg gatctggatt gggggagcag
      361 cagaagcagc aggagcaggt gccactttgg tcgggtctaa agcgaggtcc accacgtgct
      421 ctcaagtttc ccactgtgga ggaggtatac gatcggatcc aggcgattct gggtgtcgat
      481 ttgcagggga ataaaacgga gtccacagag aaaccattgc caaaagattt gcccaacgag
      541 gaggcccaaa aagaccagga atccaaggaa ctacctgagc aagagccaaa aaaactaacc
      601 aaagccaaga gacagccaaa agccccgaag aagccaacga aatccccgga agaaatggat
      661 aaagagccac cacaaagcag tcaaaaacgc aagcgaacca ccagatcctc cacagaagaa
      721 gcttccacat ctgccaaacg caggaaatag ttgttaccga gccaatcccc tccagcaata
      781 gagctttatg attgatgatg ggccaatcct cgcgaggaac ccatcattaa gaacacccct
      841 tgcctttgct ggatggtttt ttaaggttac gagaaaaaca cttgtgcacg tttgttatta
      901 caaaatatat taaaacatct tagaaaccta