Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017160599 930 bp mRNA linear INV 09-DEC-2024 ACCESSION XM_017160599 VERSION XM_017160599.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017160599.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..930 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..930 /gene="BthD" /note="BthD selenoprotein; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 Proteins" /db_xref="GeneID:108070212" CDS 94..750 /gene="BthD" /codon_start=1 /transl_except=(pos:202..204,aa:Sec) /product="selenoprotein BthD" /protein_id="XP_017016088.2" /db_xref="GeneID:108070212" /translation="MPPKRAKKAAEPAAREDEAAELDPNEPVLHVEHCRSURVFRRRA KDLHSALRERGLRRLQLRLNASGAPRRGAFELALQPGLGSGLGEQQKQQEQVPLWSGL KRGPPRALKFPTVEEVYDRIQAILGVDLQGNKTESTEKPLPKDLPNEEAQKDQESKEL PEQEPKKLTKAKRQPKAPKKPTKSPEEMDKEPPQSSQKRKRTTRSSTEEASTSAKRRK " polyA_site 930 /gene="BthD" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 taatagcaag ggcattcctt cgttatttca ccatctggca acgctgtaaa ttaaaggcgc 61 aaattgtctt aaaaattcca aaccaaactt aagatgccac caaaaagggc caaaaaagcg 121 gcggagccag ccgctcggga ggatgaagcc gcagaactgg atcccaacga accggtgctc 181 catgtggagc actgtcgttc ctgacgcgtc tttcgtcgtc gggcgaagga tctgcactct 241 gctctgcggg aacgcggtct ccgtcgcctt cagctgcgac tgaatgcatc cggagcaccg 301 cggcgaggcg ccttcgagtt ggccttgcag ccgggattgg gatctggatt gggggagcag 361 cagaagcagc aggagcaggt gccactttgg tcgggtctaa agcgaggtcc accacgtgct 421 ctcaagtttc ccactgtgga ggaggtatac gatcggatcc aggcgattct gggtgtcgat 481 ttgcagggga ataaaacgga gtccacagag aaaccattgc caaaagattt gcccaacgag 541 gaggcccaaa aagaccagga atccaaggaa ctacctgagc aagagccaaa aaaactaacc 601 aaagccaaga gacagccaaa agccccgaag aagccaacga aatccccgga agaaatggat 661 aaagagccac cacaaagcag tcaaaaacgc aagcgaacca ccagatcctc cacagaagaa 721 gcttccacat ctgccaaacg caggaaatag ttgttaccga gccaatcccc tccagcaata 781 gagctttatg attgatgatg ggccaatcct cgcgaggaac ccatcattaa gaacacccct 841 tgcctttgct ggatggtttt ttaaggttac gagaaaaaca cttgtgcacg tttgttatta 901 caaaatatat taaaacatct tagaaaccta