Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017160585 1914 bp mRNA linear INV 09-DEC-2024 (Tcs4), mRNA. ACCESSION XM_017160585 VERSION XM_017160585.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017160585.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1914 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1914 /gene="Tcs4" /note="Threonyl-carbamoyl synthesis 4; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:108070203" CDS 14..1258 /gene="Tcs4" /codon_start=1 /product="probable tRNA N6-adenosine threonylcarbamoyltransferase, mitochondrial" /protein_id="XP_017016074.2" /db_xref="GeneID:108070203" /translation="MHALRCLAGNWIQIPIPRASAAGGATRRRLSYVLGIETSCDDTG IAIVDTAGRVRANVLDSQQEFHTRYGGIIPPRAQDLHRARIESAYQRCLAEAQLQPED LAAIAVTTRPGLPLSLLVGLRFARHLARRLQKPLLPVHHMEAHALQARMEHKEICFPF LCLLASGGHCQLVVVHGPGRLTLLGQTLDDAPGEAFDKIGRRLRLHILPEYRLWNGGR AIEHAARLASDPLAYDFPLPLAQQRNCSFSFAGIKNNSFRAIRRRELSERTPPDGVIS NYGDFCAGLLRAVSRHLMHRTQRAIEYCLLPQLRLFGDAPPTLVMSGGVANNDAIYAN IAHLAEQYGCRSYRPSKRYCSDNGVMIAWHGVEQLLQDKQGSLRFDYDSIDIQGSAGF AECHEEAVQAAAIKCKWIQPLG" misc_feature 110..1126 /gene="Tcs4" /note="nucleotide-binding domain (NBD) of O-sialoglycoprotein endopeptidase-like protein 1 (OSGEPL1) and similar proteins from eukayotes; Region: ASKHA_NBD_OSGEPL1_QRI7_euk; cd24134" /db_xref="CDD:466984" polyA_site 1914 /gene="Tcs4" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 ccgataaacg attatgcatg cactcaggtg tttagccggc aattggattc agattccaat 61 tccaagagca agtgcagccg gaggagcgac caggaggcgg ctcagttatg tcctgggcat 121 cgagacctcc tgcgacgaca cgggcatcgc catcgtggac accgccggcc gggtgagggc 181 gaatgtgctg gactcgcagc aggagttcca caccagatac ggaggcatca ttccgccgcg 241 ggcccaggac ctccaccgcg cccgcatcga gtccgcctac cagcgctgcc tggcggaggc 301 gcagctgcag ccggaggatc tagcggccat tgcggtcacg acgcgtcccg gcctgccgct 361 gagcctgctg gtcggcctgc gcttcgcccg ccacctggcc cgtcgcctgc agaagcccct 421 gctgcccgtc caccacatgg aggcgcatgc tctgcaggcg cgcatggagc acaaggagat 481 ctgctttccc ttcctctgcc tcctggccag cggcggccac tgccagctgg ttgtggtcca 541 tggcccggga cgcctcactc tgcttggcca gaccttggac gatgcgcccg gcgaggcgtt 601 cgacaagatc ggacgccgcc tgcgcctgca catcctgccc gagtaccgcc tgtggaacgg 661 cggccgagcc atcgagcacg ccgcccggtt ggccagcgat ccgctggcct acgacttccc 721 gctgccgctc gcccagcagc gcaactgcag cttcagcttt gcgggcatca agaacaactc 781 ctttcgcgct atccgcaggc gagagctttc cgaacggacg cctccggatg gggtgatcag 841 taattacggg gacttttgcg ccggcctgct gcgcgccgtc agccggcatt tgatgcaccg 901 cacccagcgg gccatcgagt actgcctcct gccgcagctg cgtctcttcg gcgacgcccc 961 gcccacgctg gtcatgtccg gcggggtggc caacaacgat gccatctacg cgaatatcgc 1021 tcacctggcc gagcagtacg gatgccgcag ctaccggccg tccaagcgct actgctccga 1081 caacggggtg atgatcgcct ggcacggagt ggagcagctg ctgcaagaca agcagggcag 1141 cctgcgcttc gactacgaca gcatcgacat ccagggcagc gcgggattcg ccgaatgcca 1201 cgaggaggct gtgcaagcgg cggccatcaa gtgcaagtgg atacagccac tgggctaagt 1261 tcctgttcat agttttaagc atttcttgag taaatatttg ttattaaagg gtgatctccc 1321 ttgaaatcgt tcaaattata agctagtttg ttttgccctc ttgagaagat ggaatgcata 1381 ttttattgtc tggtttaaaa catgaaaaaa ggatttttat aaacgtaatt aacttaaatg 1441 ttgctttaaa caattatccg aaatggatat tcaatcaatt tccttgttca tccagtcaat 1501 tgaaataatt tcccatatat ttgggataaa ttgttcaaat tataagctag tttgtttcgc 1561 ccttttgaga agatggaatg catattttat tgtccggttt aaaacatgaa agtagttaaa 1621 gaagcataaa ttgtaaagta attaacttaa atgaattttc cattaatttc cctgttcatc 1681 cagccaattg aaataatttc ccatatattt gggatattaa atgattttat ttcaagaatc 1741 ccaacttatt gtttcattgt ttactgcctt gctccacaca gaaaataatg gtttcgtttt 1801 ggatttcgtt ttattataag atattatctg aaatcaataa tgttaaatca ctaaggtcta 1861 gaaaaaaaat gtaaaaattg ataatgtata catataaaaa tagtaaaaaa tgca