Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii transport and golgi organization 2


LOCUS       XM_017160579            1409 bp    mRNA    linear   INV 09-DEC-2024
            (Tango2), transcript variant X2, mRNA.
ACCESSION   XM_017160579
VERSION     XM_017160579.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017160579.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1409
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1409
                     /gene="Tango2"
                     /note="transport and golgi organization 2; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 3 Proteins"
                     /db_xref="GeneID:108070197"
     CDS             452..1303
                     /gene="Tango2"
                     /codon_start=1
                     /product="transport and Golgi organization protein 2
                     isoform X2"
                     /protein_id="XP_017016068.2"
                     /db_xref="GeneID:108070197"
                     /translation="MCVIFFCADSNPQLGGYKLILASNRDEFFARATQSAAKWANADH
                     VYGGIDLEPGREGGTWLAIGHSAGFFKVGALLNLTGEPKPRDAVGRGMIVADFVTQAD
                     EEHSIRNYNQRLLKDCTKYSAFNFVSIEIGSPSLPARVELLSNVPPTLEEFRNGGCYG
                     FGNSLPHTPFEKVRHGQQEFEAIVREHGGASVETLSSQLMQLLRNKHRFWPDAELKRR
                     APNWGEGLSALNVHIADHAYGSRTHTVILVDSQNRMHFIEETMAGLDPQGEWSRTHIE
                     KDFPGYV"
     misc_feature    452..1234
                     /gene="Tango2"
                     /note="Transport and Golgi organization 2; Region: TANGO2;
                     pfam05742"
                     /db_xref="CDD:461729"
     polyA_site      1409
                     /gene="Tango2"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 acgcttaaaa aataaaaata taaaaagtga aaccaaaaca agcgaacacc aaccaacgaa
       61 atagatgaaa atacagcttt gttcgcgatt aaagactgtt tttgggacgt aaatagatcg
      121 caaatagggg cccgtttcat ggaaaaaaca cccaccaagc taaccgcacc gaacccattt
      181 actaaccgat ttagattagc tgcgttcgta aacaacggat aagactgtat atcagctgta
      241 cgttaattta gtgataaaac catcgtagag ccacagcaac aaagagactg aactgaacga
      301 cctgccattt tgataccgac accccgtcga gattaaagcc aatttttgga tccgatcccc
      361 agttgtccgc cgacttctaa gcacctcgca tcgctacttt gtaaccggac tatagtcgca
      421 tatatcctat atagtattgc acatatatac gatgtgcgtg atattcttct gtgcggactc
      481 caatccgcag ctgggtggct acaagctcat tttggcctcc aatcgggacg agttcttcgc
      541 cagggccacc caatccgcgg ccaagtgggc gaatgccgat catgtttacg gtggaatcga
      601 tttagagccg ggacgcgagg gtggaacctg gctggccatc ggccactccg cgggcttctt
      661 caaggtgggc gccctgctca acctgaccgg cgagcccaag ccccgcgatg cagtcgggcg
      721 cggcatgatc gtggctgact tcgtcaccca ggcggacgag gagcacagca tccggaacta
      781 caaccagagg ctcctcaagg actgcaccaa gtacagtgcc ttcaactttg tgtccatcga
      841 gattggatct ccatcgctgc ccgcacgcgt ggagctgctg agcaatgtgc cgccgacgct
      901 ggaggagttc cggaacggcg gttgctacgg attcggcaac agcctgccac acacgccctt
      961 cgagaaggtg cgccacggcc agcaggagtt cgaggcgata gtgcgggagc atgggggtgc
     1021 cagtgtggag accctctcct cccaactgat gcagctgctg aggaacaagc accgattctg
     1081 gccagatgcc gagctaaaaa ggcgggcgcc caactggggc gagggcttga gtgccctcaa
     1141 cgtgcacatt gcagaccatg cctacggcag tcggacgcac acggtcatcc tggtggacag
     1201 ccagaacagg atgcacttca ttgaggaaac gatggccgga ctggatccgc agggcgagtg
     1261 gagcaggacg cacatcgaaa aggattttcc gggctatgta tagaatatat atatcaggaa
     1321 tttgcttcct ccactaattt gtaatctgta atctgtattt tgactctggc atttacgata
     1381 ataaatagtc atagctactt aactattaa