Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii ribonuclease P protein subunit p20


LOCUS       XM_017160563             593 bp    mRNA    linear   INV 09-DEC-2024
            (Rpp20), mRNA.
ACCESSION   XM_017160563
VERSION     XM_017160563.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017160563.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..593
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..593
                     /gene="Rpp20"
                     /note="ribonuclease P protein subunit p20; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 2 Proteins"
                     /db_xref="GeneID:108070191"
     CDS             93..593
                     /gene="Rpp20"
                     /codon_start=1
                     /product="ribonuclease P protein subunit p20"
                     /protein_id="XP_017016052.2"
                     /db_xref="GeneID:108070191"
                     /translation="MMGSNPPEHGTKPRSTRPHRQQNHRVVRKQPPRPAVSSDRHNIY
                     ITSKTDFKAQQRRCEELLNSGAREIFLHCMGFSVTRGLNLALRLVHNSEGALSYAINT
                     STVHLVDELHPLSDDQDVTFRQRNNSALHIKIFNRSLFDIVVPQPSQSQNQSLGQFRG
                     KPKPRQ"
     misc_feature    219..491
                     /gene="Rpp20"
                     /note="Rpp20 subunit of nuclear RNase MRP and P; Region:
                     Rpp20; pfam12328"
                     /db_xref="CDD:372048"
ORIGIN      
        1 acgcggccag tgttgggcag cgactggagt ccgaatctgt gacacgcgca gatgggaaga
       61 aacacaagtc gcctcctccg ccgccgccgt tgatgatggg cagcaatcct cccgagcacg
      121 ggaccaagcc gagatccacc agaccccaca gacaacagaa ccaccgagtg gtgcgcaagc
      181 agccgccgcg accggccgtc agcagcgacc gccacaacat ctacatcacc agcaagacgg
      241 atttcaaggc ccagcagcgc cgctgcgagg agctgctgaa ctccggtgcc cgcgagatct
      301 tcctgcactg catgggcttc tcggtcaccc gcggcctcaa tctcgccctg cgcctcgtcc
      361 acaactcgga gggcgccctc agctacgcga tcaacacgtc caccgtccac ctggtggacg
      421 agctgcatcc gctgagcgat gaccaggacg taaccttccg gcagcgcaac aactcggccc
      481 tgcacatcaa gatcttcaat cgcagcctct tcgacatcgt tgtgccgcag ccctcgcagt
      541 cccagaacca atcccttggc caattccggg gcaaaccgaa gcccaggcag tag