Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017160563 593 bp mRNA linear INV 09-DEC-2024 (Rpp20), mRNA. ACCESSION XM_017160563 VERSION XM_017160563.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017160563.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..593 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..593 /gene="Rpp20" /note="ribonuclease P protein subunit p20; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:108070191" CDS 93..593 /gene="Rpp20" /codon_start=1 /product="ribonuclease P protein subunit p20" /protein_id="XP_017016052.2" /db_xref="GeneID:108070191" /translation="MMGSNPPEHGTKPRSTRPHRQQNHRVVRKQPPRPAVSSDRHNIY ITSKTDFKAQQRRCEELLNSGAREIFLHCMGFSVTRGLNLALRLVHNSEGALSYAINT STVHLVDELHPLSDDQDVTFRQRNNSALHIKIFNRSLFDIVVPQPSQSQNQSLGQFRG KPKPRQ" misc_feature 219..491 /gene="Rpp20" /note="Rpp20 subunit of nuclear RNase MRP and P; Region: Rpp20; pfam12328" /db_xref="CDD:372048" ORIGIN 1 acgcggccag tgttgggcag cgactggagt ccgaatctgt gacacgcgca gatgggaaga 61 aacacaagtc gcctcctccg ccgccgccgt tgatgatggg cagcaatcct cccgagcacg 121 ggaccaagcc gagatccacc agaccccaca gacaacagaa ccaccgagtg gtgcgcaagc 181 agccgccgcg accggccgtc agcagcgacc gccacaacat ctacatcacc agcaagacgg 241 atttcaaggc ccagcagcgc cgctgcgagg agctgctgaa ctccggtgcc cgcgagatct 301 tcctgcactg catgggcttc tcggtcaccc gcggcctcaa tctcgccctg cgcctcgtcc 361 acaactcgga gggcgccctc agctacgcga tcaacacgtc caccgtccac ctggtggacg 421 agctgcatcc gctgagcgat gaccaggacg taaccttccg gcagcgcaac aactcggccc 481 tgcacatcaa gatcttcaat cgcagcctct tcgacatcgt tgtgccgcag ccctcgcagt 541 cccagaacca atcccttggc caattccggg gcaaaccgaa gcccaggcag tag