PREDICTED: Drosophila takahashii Cytochrome c oxidase subunit 6B

LOCUS       XM_017160562             621 bp    mRNA    linear   INV 09-DEC-2024
            (COX6B), transcript variant X2, mRNA.
ACCESSION   XM_017160562
VERSION     XM_017160562.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017160562.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..621
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..621
                     /gene="COX6B"
                     /note="Cytochrome c oxidase subunit 6B; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 3 Proteins"
                     /db_xref="GeneID:108070190"
     CDS             160..393
                     /gene="COX6B"
                     /codon_start=1
                     /product="cytochrome c oxidase subunit 6B1"
                     /protein_id="XP_017016051.1"
                     /db_xref="GeneID:108070190"
                     /translation="MSAYKLETAPFDPRFPNQNVTRYCYQSYIDFHRCQKKRGEDFAP
                     CNYFQKVYKSMCPNAWVEKWDDQRESGTFPGRI"
     misc_feature    166..387
                     /gene="COX6B"
                     /note="Cytochrome c oxidase subunit VIb. Cytochrome c
                     oxidase (CcO), the terminal oxidase in the respiratory
                     chains of eukaryotes and most bacteria, is a multi-chain
                     transmembrane protein located in the inner membrane of
                     mitochondria and the cell membrane of...; Region:
                     Cyt_c_Oxidase_VIb; cd00926"
                     /db_xref="CDD:238466"
     misc_feature    order(175..186,211..222,307..309,316..336)
                     /gene="COX6B"
                     /note="Subunit VIb/II interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238466"
     misc_feature    211..213
                     /gene="COX6B"
                     /note="Subunit VIb/I interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238466"
     misc_feature    order(223..225,232..234,379..381)
                     /gene="COX6B"
                     /note="Subunit VIb/III interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238466"
     misc_feature    order(271..273,277..294)
                     /gene="COX6B"
                     /note="Subunit VIb/VIb interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238466"
     misc_feature    order(358..360,367..375)
                     /gene="COX6B"
                     /note="Subunit VIb/VIa interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238466"
     polyA_site      621
                     /gene="COX6B"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 cgacgatctg gcaacccggc cctagctgtc acgctgacag ctctcgatac ttttcgtcca
       61 tcgccaatct atcgtcgggc tcgtgagatt ctcgccagtt gaaaattttt cgtcgtactc
      121 tcgtaacaac aaagcgacaa atcgtcagac agcagcaaca tgtccgccta caagctggag
      181 accgccccct tcgatccacg gttccccaac cagaacgtga cccgctactg ctaccagtcg
      241 tacatcgact tccaccgctg ccagaagaag cgcggcgagg actttgcgcc ctgcaactac
      301 ttccagaagg tctacaagtc gatgtgtccc aacgcctggg tggagaagtg ggacgaccag
      361 cgcgagagcg gcacattccc gggccgcatc tagagatcta gaggtcaccg caaccccaaa
      421 caccaacccc aaagcacaca gaggacacga tggatgggcg gacgtagcga agtagcgacg
      481 tagaggagtg tggccatcag aatccagcaa ttgcaacaga gactacttgt tcatgtttgt
      541 gctttcccga gcgatgaatg cagattatcg tcgtcaaata caaatacaca aatgttcaat
      601 taactgaatt ctgaatccga a