PREDICTED: Drosophila takahashii Cytochrome c oxidase subunit 6B

LOCUS       XM_017160561             618 bp    mRNA    linear   INV 09-DEC-2024
            (COX6B), transcript variant X1, mRNA.
ACCESSION   XM_017160561
VERSION     XM_017160561.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017160561.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..618
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..618
                     /gene="COX6B"
                     /note="Cytochrome c oxidase subunit 6B; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 3 Proteins"
                     /db_xref="GeneID:108070190"
     CDS             157..390
                     /gene="COX6B"
                     /codon_start=1
                     /product="cytochrome c oxidase subunit 6B1"
                     /protein_id="XP_017016050.1"
                     /db_xref="GeneID:108070190"
                     /translation="MSAYKLETAPFDPRFPNQNVTRYCYQSYIDFHRCQKKRGEDFAP
                     CNYFQKVYKSMCPNAWVEKWDDQRESGTFPGRI"
     misc_feature    163..384
                     /gene="COX6B"
                     /note="Cytochrome c oxidase subunit VIb. Cytochrome c
                     oxidase (CcO), the terminal oxidase in the respiratory
                     chains of eukaryotes and most bacteria, is a multi-chain
                     transmembrane protein located in the inner membrane of
                     mitochondria and the cell membrane of...; Region:
                     Cyt_c_Oxidase_VIb; cd00926"
                     /db_xref="CDD:238466"
     misc_feature    order(172..183,208..219,304..306,313..333)
                     /gene="COX6B"
                     /note="Subunit VIb/II interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238466"
     misc_feature    208..210
                     /gene="COX6B"
                     /note="Subunit VIb/I interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238466"
     misc_feature    order(220..222,229..231,376..378)
                     /gene="COX6B"
                     /note="Subunit VIb/III interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238466"
     misc_feature    order(268..270,274..291)
                     /gene="COX6B"
                     /note="Subunit VIb/VIb interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238466"
     misc_feature    order(355..357,364..372)
                     /gene="COX6B"
                     /note="Subunit VIb/VIa interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238466"
     polyA_site      618
                     /gene="COX6B"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tctggcaacc cggccctagc tgtcacgctg acagctctcg atacttttcg tccatcgcca
       61 atctatcgtc gggctcgtga gattctcgcc agttgaaaat ttttcgtcgt actctcgtaa
      121 caacaaagca gcgacaaatc gtcagacagc agcaacatgt ccgcctacaa gctggagacc
      181 gcccccttcg atccacggtt ccccaaccag aacgtgaccc gctactgcta ccagtcgtac
      241 atcgacttcc accgctgcca gaagaagcgc ggcgaggact ttgcgccctg caactacttc
      301 cagaaggtct acaagtcgat gtgtcccaac gcctgggtgg agaagtggga cgaccagcgc
      361 gagagcggca cattcccggg ccgcatctag agatctagag gtcaccgcaa ccccaaacac
      421 caaccccaaa gcacacagag gacacgatgg atgggcggac gtagcgaagt agcgacgtag
      481 aggagtgtgg ccatcagaat ccagcaattg caacagagac tacttgttca tgtttgtgct
      541 ttcccgagcg atgaatgcag attatcgtcg tcaaatacaa atacacaaat gttcaattaa
      601 ctgaattctg aatccgaa