Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017160542 856 bp mRNA linear INV 09-DEC-2024 domain-containing protein 2 (LOC108070178), mRNA. ACCESSION XM_017160542 VERSION XM_017160542.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017160542.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..856 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..856 /gene="LOC108070178" /note="fatty acid hydroxylase domain-containing protein 2; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108070178" CDS 10..849 /gene="LOC108070178" /codon_start=1 /product="fatty acid hydroxylase domain-containing protein 2" /protein_id="XP_017016031.2" /db_xref="GeneID:108070178" /translation="MDTLLAGWTQSGDFLQDKWTSLLDTVGEDAWRLWVVGSTLVIFS VYWLYAGLFTLMDITNRPRFLRKYKIQPGQNEPVDLAKLWSAVKIVLLNLTVVNFLAC WAVYELVYKTENSQDIRELPTFRRSLRDLAVFVVLEEIMFYYAHRLLHHRSVYKYVHK KHHEWTAPIAAITLYAHPVEHVVANLLPVATSIALLGTHVALAYVIFALAIVNSMSDH TGYSFPWSAGSVRFHDYHHAKFNYNYGVLGLLDKLHGTYRTPADQKKAPVSRIKKSKK KSS" misc_feature 400..777 /gene="LOC108070178" /note="Fatty acid hydroxylase; Region: FA_hydroxylase; pfam04116" /db_xref="CDD:397991" ORIGIN 1 tcgaccgcaa tggacacctt gctggctggc tggacgcaat ccggggactt cctgcaggac 61 aagtggacct ctctgctgga caccgtgggc gaggatgcgt ggcgcctgtg ggtggtgggc 121 agcacgctgg tcatcttctc cgtctactgg ctctacgcgg gcctcttcac gctgatggac 181 atcacgaatc gtccgcgctt cctgcgcaaa tacaagatcc agccgggcca aaatgagcca 241 gtggatctgg ccaagctctg gagcgccgtc aagatcgtcc tgctcaatct gacggtggtc 301 aacttcctgg cctgctgggc ggtatacgag ctggtctaca agacggagaa cagccaggac 361 atccgggagc tgcccacctt caggagatcg ctgcgcgacc tggccgtctt tgtggttctg 421 gaggagatca tgttctacta cgcccaccgg ctgctccacc accgctcggt gtacaagtat 481 gtccacaaga agcaccacga gtggacggcc cccatcgccg ccatcacgct ttatgctcat 541 cccgtggagc atgtggtggc caatctgctg ccggtggcca cctccatcgc cctcctgggc 601 acccacgtgg ccctggccta cgtgatcttc gccctggcca tcgtcaactc gatgagcgac 661 cacacgggct acagcttccc ctggtcggcg ggatcggtgc ggttccacga ctaccaccat 721 gccaagttca actacaatta cggagtgctc ggcctgctgg acaagctgca tggcacatat 781 cgcactcctg cggaccagaa gaaggctcct gtgtccagga taaagaagtc caagaagaag 841 tctagttagt cccagt