Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii fatty acid hydroxylase


LOCUS       XM_017160542             856 bp    mRNA    linear   INV 09-DEC-2024
            domain-containing protein 2 (LOC108070178), mRNA.
ACCESSION   XM_017160542
VERSION     XM_017160542.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017160542.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..856
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..856
                     /gene="LOC108070178"
                     /note="fatty acid hydroxylase domain-containing protein 2;
                     Derived by automated computational analysis using gene
                     prediction method: Gnomon. Supporting evidence includes
                     similarity to: 1 Protein"
                     /db_xref="GeneID:108070178"
     CDS             10..849
                     /gene="LOC108070178"
                     /codon_start=1
                     /product="fatty acid hydroxylase domain-containing protein
                     2"
                     /protein_id="XP_017016031.2"
                     /db_xref="GeneID:108070178"
                     /translation="MDTLLAGWTQSGDFLQDKWTSLLDTVGEDAWRLWVVGSTLVIFS
                     VYWLYAGLFTLMDITNRPRFLRKYKIQPGQNEPVDLAKLWSAVKIVLLNLTVVNFLAC
                     WAVYELVYKTENSQDIRELPTFRRSLRDLAVFVVLEEIMFYYAHRLLHHRSVYKYVHK
                     KHHEWTAPIAAITLYAHPVEHVVANLLPVATSIALLGTHVALAYVIFALAIVNSMSDH
                     TGYSFPWSAGSVRFHDYHHAKFNYNYGVLGLLDKLHGTYRTPADQKKAPVSRIKKSKK
                     KSS"
     misc_feature    400..777
                     /gene="LOC108070178"
                     /note="Fatty acid hydroxylase; Region: FA_hydroxylase;
                     pfam04116"
                     /db_xref="CDD:397991"
ORIGIN      
        1 tcgaccgcaa tggacacctt gctggctggc tggacgcaat ccggggactt cctgcaggac
       61 aagtggacct ctctgctgga caccgtgggc gaggatgcgt ggcgcctgtg ggtggtgggc
      121 agcacgctgg tcatcttctc cgtctactgg ctctacgcgg gcctcttcac gctgatggac
      181 atcacgaatc gtccgcgctt cctgcgcaaa tacaagatcc agccgggcca aaatgagcca
      241 gtggatctgg ccaagctctg gagcgccgtc aagatcgtcc tgctcaatct gacggtggtc
      301 aacttcctgg cctgctgggc ggtatacgag ctggtctaca agacggagaa cagccaggac
      361 atccgggagc tgcccacctt caggagatcg ctgcgcgacc tggccgtctt tgtggttctg
      421 gaggagatca tgttctacta cgcccaccgg ctgctccacc accgctcggt gtacaagtat
      481 gtccacaaga agcaccacga gtggacggcc cccatcgccg ccatcacgct ttatgctcat
      541 cccgtggagc atgtggtggc caatctgctg ccggtggcca cctccatcgc cctcctgggc
      601 acccacgtgg ccctggccta cgtgatcttc gccctggcca tcgtcaactc gatgagcgac
      661 cacacgggct acagcttccc ctggtcggcg ggatcggtgc ggttccacga ctaccaccat
      721 gccaagttca actacaatta cggagtgctc ggcctgctgg acaagctgca tggcacatat
      781 cgcactcctg cggaccagaa gaaggctcct gtgtccagga taaagaagtc caagaagaag
      841 tctagttagt cccagt