Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii ribonuclease H2 subunit B


LOCUS       XM_017160541            1172 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108070176), mRNA.
ACCESSION   XM_017160541
VERSION     XM_017160541.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017160541.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1172
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1172
                     /gene="LOC108070176"
                     /note="ribonuclease H2 subunit B; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 2
                     Proteins"
                     /db_xref="GeneID:108070176"
     CDS             74..1099
                     /gene="LOC108070176"
                     /codon_start=1
                     /product="ribonuclease H2 subunit B"
                     /protein_id="XP_017016030.2"
                     /db_xref="GeneID:108070176"
                     /translation="MSKKATRGSKPKPEPDAEGSGKKTTAASLKKVMFLSQELLPKDA
                     DEGRLRLERFFHPGQGKEALFVTHPDGQMMELLEYAEPRRSWLVNSEVCSNGRIYMTT
                     PVDPTLLALHHLRKHCAQRAMSLDNIAVEEASTSRLLNEILAPESLKCVADVKSSGDQ
                     RFYKYNQERTLAWLALKARQVAGVLKEKQIHCGHSAQSQNFVRSEKVAAESVSHEMDY
                     TRMACDIVGRYLDADLHGLLTAYLHIPSEIQAMVEEKAAAQKRKSKAGQDEGSDSKKI
                     KLNESDAAAKLKSSGLVDSDNDPNASITSPTSAAPLKERSLTAKEKALAKGAKGTKSI
                     ASFFKVK"
     misc_feature    188..1090
                     /gene="LOC108070176"
                     /note="Ribonuclease H2-B is a subunit of the eukaryotic
                     RNase H complex which cleaves RNA-DNA hybrids; Region:
                     RNase_H2-B; cd09270"
                     /db_xref="CDD:187751"
     misc_feature    order(188..196,230..232,299..301,323..337)
                     /gene="LOC108070176"
                     /note="heterotrimeric interface; other site"
                     /db_xref="CDD:187751"
ORIGIN      
        1 tctgtgtttt tgtttggcca gagcaattgt tatttacatt taacacttag ttttgattaa
       61 attacccggc agaatgagca agaaggcaac gcgcggcagc aaaccgaaac cggaaccgga
      121 tgcggaggga tctggcaaga agacaacggc cgcttcgctg aagaaggtga tgtttctgtc
      181 gcaggaactg ctgcccaagg atgcggacga agggcgcctc cggctggagc gcttctttca
      241 ccctggccaa gggaaggagg cgctgttcgt cacccatccc gatggccaga tgatggagct
      301 gctggagtac gcggagccgc gtcgcagttg gctggtgaat agcgaggtct gctcgaatgg
      361 caggatctac atgaccacgc ccgtggatcc cacgctcctg gccctccatc acctgcggaa
      421 gcactgtgct cagcgcgcaa tgtcgctgga caacattgcg gtggaggagg ccagcaccag
      481 ccgcctgctc aacgagatcc tcgcgccaga gagcctgaag tgtgtggcgg atgtgaagag
      541 ctccggcgac cagcggttct acaagtacaa ccaggagcga acgctggcct ggctggcgct
      601 caaggcgcgc caggtggcgg gcgtcctgaa ggagaagcag atccactgcg ggcacagtgc
      661 ccagtcgcag aacttcgtgc gcagcgagaa ggtggcggcg gaaagtgtca gccacgaaat
      721 ggactacaca cgcatggcct gcgacattgt gggccgctac ttggatgcgg atctgcatgg
      781 cctgctcacc gcctacctgc acattcccag cgagattcag gcgatggtcg aggagaaggc
      841 cgccgcccag aagcggaaat cgaaggcggg ccaggacgag ggcagcgact ccaagaagat
      901 caagctcaac gagagcgatg ccgccgcgaa gcttaagagc agcggcctgg tggacagcga
      961 caacgatccc aatgccagca tcacatcgcc cacgtcggcg gctccgctca aggaacgctc
     1021 gctgaccgcc aaggaaaagg ccctggccaa gggcgccaag ggcaccaaga gcatcgcatc
     1081 gttcttcaaa gtgaagtaga tttaggtttc ggataagtta ttaataggtt catgtttcct
     1141 agcgtgaact tccgcttaca attttttttg cc