Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017160531 1967 bp mRNA linear INV 09-DEC-2024 (LOC108070168), mRNA. ACCESSION XM_017160531 VERSION XM_017160531.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017160531.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1967 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1967 /gene="LOC108070168" /note="nudC domain-containing protein 1; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:108070168" CDS 103..1815 /gene="LOC108070168" /codon_start=1 /product="nudC domain-containing protein 1" /protein_id="XP_017016020.2" /db_xref="GeneID:108070168" /translation="MPVVELSVDRSLVCPSFDGYKLSFDPVPVLRQDLDSDPLVQEPH ANQYSLLHVELFGRHNHLVADPWRRHCSYYMTARHQLMQCDYDPQSGQALGQRVVFSL EYRDQGDGHQHLAGDYNYTIAFVSERFCVICDGMTSYHLVDTGDRSRSGAQNWERIAR TPVDQSSDQRGFALFDARLDVVQERKQISLVAGHVARREAVSSRQDHQTHVYYMALTW ARWSQSSAAGGEWSYAVCQRLETTGSVHYCAFEPRAESLILASNREVQTPEQRQAAEE AAANAPPAVPADEQLQQPYHFSQTADKVLIRLEVPSGASKDEFNVRCTPSSLAVDYAD QEIFSGELYANVNEDFINWSLEELLEVSLSKAEQKEWPRLLAQNEGEAAAPLPIPNLE DPIEECDLGLPDEDFKMVRFNLSTGSITHTIFLGSTPLLFSATLRPGFPAAFATRQGV DASIWLQMHQPSRPDEWSVRHEGQLHAFGYVQASKEQRKFTGCCPELEYVAICESIRH VLVYRPRHDSAGGLRKRNGPPVTVGKQNLITLDYTVGEILGMSTASNVLTILTRHALL HLQV" misc_feature 985..1227 /gene="LOC108070168" /note="p23_like domain of NUD (nuclear distribution) C and similar proteins. Aspergillus nidulas (An) NUDC is needed for nuclear movement. AnNUDC is localized at the hyphal cortex, and binds NUDF at spindle pole bodies (SPBs) and in the cytoplasm at different...; Region: p23_NUDC_like; cd06467" /db_xref="CDD:107224" polyA_site 1967 /gene="LOC108070168" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 ttttgacatt tagatttgtt gtcctgtccc gtcttgtcga attggaattt ccgaaagcat 61 aagtttttac agttttgagg ccggatctgg aatctccaaa tcatgccggt ggtggagctg 121 agcgtggacc gcagcctggt gtgtccgagc ttcgatggct acaagctgtc cttcgatccg 181 gtgccggtgc tccgtcagga cctggatagc gatcccctcg tccaggagcc gcacgccaat 241 cagtactcgc tgctgcacgt ggagctcttc ggccggcaca atcacctggt ggcggatccc 301 tggcggcgcc actgcagcta ctacatgacc gcgcgccacc agctgatgca gtgcgactac 361 gatccgcaaa gtggtcaggc gcttggtcag cgtgtcgtct tctcgctgga gtaccgcgac 421 cagggcgacg gtcatcagca tttggcaggc gactacaact acacgatcgc cttcgtttcg 481 gagcgcttct gtgtgatctg cgatggaatg acctcgtacc acctggtgga cacgggcgat 541 cgatcgcgtt ccggggcgca gaactgggag cggattgccc gaacgccggt ggatcagagc 601 agcgatcagc gcggctttgc cctgttcgat gcccggctgg atgtggtgca ggagcgcaag 661 caaatctccc tggtggccgg ccatgtggca cgaagggagg ctgtctcgtc gcggcaggat 721 catcagacgc atgtctacta catggccctc acctgggcac gctggtcgca atcgtcggct 781 gccggtggcg agtggtcata tgccgtctgc cagcgtctgg agaccacggg ctctgtgcac 841 tattgcgcct ttgagccgcg cgccgagtcc ctgatcctgg ccagcaatcg cgaggtgcag 901 acgcccgagc agcgacaggc ggccgaagaa gccgctgcaa atgccccacc tgcagttcct 961 gcggatgagc agctgcaaca gccataccac ttttcccaga cggcggacaa ggtgctcatc 1021 cgcttggaag tgcccagcgg tgcctccaag gacgagttca acgtgcgctg cacgcccagc 1081 agtctggcgg tggattatgc ggatcaggag atcttcagcg gtgagctgta cgccaatgtc 1141 aacgaggatt tcatcaattg gtcattagag gaactcctgg aagtgtcgct gtccaaggcg 1201 gagcaaaagg aatggcccag attgctggca cagaacgaag gcgaggcagc tgcgccgctg 1261 cccattccca atctagagga tcccatcgag gaatgcgatt tggggctgcc cgacgaggac 1321 tttaagatgg tacgcttcaa tctgtcgact ggcagcatca cgcacaccat tttcctgggc 1381 tccacaccgc tgcttttctc cgccacactg cgtcccgggt ttccggccgc ctttgccacg 1441 cgccagggcg tcgatgcctc catttggctg cagatgcacc agcccagtcg ccccgacgag 1501 tggagcgtcc ggcacgaggg acaactgcac gccttcggct atgtgcaggc ctccaaggag 1561 cagcgcaagt tcaccggctg ctgtccggag ctcgagtacg tggccatctg cgagagcatc 1621 cggcatgtgc tcgtctaccg gccgcgccac gactccgccg gcggtctgcg caagcgcaac 1681 ggtccgcccg tcaccgtcgg caagcagaac ctcatcactt tggactacac ggtcggcgag 1741 atcctgggca tgtccacggc cagcaatgtg ctcaccattc tgactaggca cgccctgctg 1801 cacctgcagg tttaggttcg gacttttcta tttttactta cgttcacaaa tttcccgttg 1861 ggcggacaat aaatgcattt cgttgagcaa tcaatgccct ctaaattaca atactgaaat 1921 gtacttcagg gaattgtttt caatatattt tgaaaaaaat ttaaaaa