Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii nudC domain-containing protein 1


LOCUS       XM_017160531            1967 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108070168), mRNA.
ACCESSION   XM_017160531
VERSION     XM_017160531.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017160531.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1967
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1967
                     /gene="LOC108070168"
                     /note="nudC domain-containing protein 1; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 2 Proteins"
                     /db_xref="GeneID:108070168"
     CDS             103..1815
                     /gene="LOC108070168"
                     /codon_start=1
                     /product="nudC domain-containing protein 1"
                     /protein_id="XP_017016020.2"
                     /db_xref="GeneID:108070168"
                     /translation="MPVVELSVDRSLVCPSFDGYKLSFDPVPVLRQDLDSDPLVQEPH
                     ANQYSLLHVELFGRHNHLVADPWRRHCSYYMTARHQLMQCDYDPQSGQALGQRVVFSL
                     EYRDQGDGHQHLAGDYNYTIAFVSERFCVICDGMTSYHLVDTGDRSRSGAQNWERIAR
                     TPVDQSSDQRGFALFDARLDVVQERKQISLVAGHVARREAVSSRQDHQTHVYYMALTW
                     ARWSQSSAAGGEWSYAVCQRLETTGSVHYCAFEPRAESLILASNREVQTPEQRQAAEE
                     AAANAPPAVPADEQLQQPYHFSQTADKVLIRLEVPSGASKDEFNVRCTPSSLAVDYAD
                     QEIFSGELYANVNEDFINWSLEELLEVSLSKAEQKEWPRLLAQNEGEAAAPLPIPNLE
                     DPIEECDLGLPDEDFKMVRFNLSTGSITHTIFLGSTPLLFSATLRPGFPAAFATRQGV
                     DASIWLQMHQPSRPDEWSVRHEGQLHAFGYVQASKEQRKFTGCCPELEYVAICESIRH
                     VLVYRPRHDSAGGLRKRNGPPVTVGKQNLITLDYTVGEILGMSTASNVLTILTRHALL
                     HLQV"
     misc_feature    985..1227
                     /gene="LOC108070168"
                     /note="p23_like domain of NUD (nuclear distribution) C and
                     similar proteins. Aspergillus nidulas (An) NUDC is needed
                     for nuclear movement. AnNUDC is localized at the hyphal
                     cortex, and binds NUDF at spindle pole bodies (SPBs) and
                     in the cytoplasm at different...; Region: p23_NUDC_like;
                     cd06467"
                     /db_xref="CDD:107224"
     polyA_site      1967
                     /gene="LOC108070168"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ttttgacatt tagatttgtt gtcctgtccc gtcttgtcga attggaattt ccgaaagcat
       61 aagtttttac agttttgagg ccggatctgg aatctccaaa tcatgccggt ggtggagctg
      121 agcgtggacc gcagcctggt gtgtccgagc ttcgatggct acaagctgtc cttcgatccg
      181 gtgccggtgc tccgtcagga cctggatagc gatcccctcg tccaggagcc gcacgccaat
      241 cagtactcgc tgctgcacgt ggagctcttc ggccggcaca atcacctggt ggcggatccc
      301 tggcggcgcc actgcagcta ctacatgacc gcgcgccacc agctgatgca gtgcgactac
      361 gatccgcaaa gtggtcaggc gcttggtcag cgtgtcgtct tctcgctgga gtaccgcgac
      421 cagggcgacg gtcatcagca tttggcaggc gactacaact acacgatcgc cttcgtttcg
      481 gagcgcttct gtgtgatctg cgatggaatg acctcgtacc acctggtgga cacgggcgat
      541 cgatcgcgtt ccggggcgca gaactgggag cggattgccc gaacgccggt ggatcagagc
      601 agcgatcagc gcggctttgc cctgttcgat gcccggctgg atgtggtgca ggagcgcaag
      661 caaatctccc tggtggccgg ccatgtggca cgaagggagg ctgtctcgtc gcggcaggat
      721 catcagacgc atgtctacta catggccctc acctgggcac gctggtcgca atcgtcggct
      781 gccggtggcg agtggtcata tgccgtctgc cagcgtctgg agaccacggg ctctgtgcac
      841 tattgcgcct ttgagccgcg cgccgagtcc ctgatcctgg ccagcaatcg cgaggtgcag
      901 acgcccgagc agcgacaggc ggccgaagaa gccgctgcaa atgccccacc tgcagttcct
      961 gcggatgagc agctgcaaca gccataccac ttttcccaga cggcggacaa ggtgctcatc
     1021 cgcttggaag tgcccagcgg tgcctccaag gacgagttca acgtgcgctg cacgcccagc
     1081 agtctggcgg tggattatgc ggatcaggag atcttcagcg gtgagctgta cgccaatgtc
     1141 aacgaggatt tcatcaattg gtcattagag gaactcctgg aagtgtcgct gtccaaggcg
     1201 gagcaaaagg aatggcccag attgctggca cagaacgaag gcgaggcagc tgcgccgctg
     1261 cccattccca atctagagga tcccatcgag gaatgcgatt tggggctgcc cgacgaggac
     1321 tttaagatgg tacgcttcaa tctgtcgact ggcagcatca cgcacaccat tttcctgggc
     1381 tccacaccgc tgcttttctc cgccacactg cgtcccgggt ttccggccgc ctttgccacg
     1441 cgccagggcg tcgatgcctc catttggctg cagatgcacc agcccagtcg ccccgacgag
     1501 tggagcgtcc ggcacgaggg acaactgcac gccttcggct atgtgcaggc ctccaaggag
     1561 cagcgcaagt tcaccggctg ctgtccggag ctcgagtacg tggccatctg cgagagcatc
     1621 cggcatgtgc tcgtctaccg gccgcgccac gactccgccg gcggtctgcg caagcgcaac
     1681 ggtccgcccg tcaccgtcgg caagcagaac ctcatcactt tggactacac ggtcggcgag
     1741 atcctgggca tgtccacggc cagcaatgtg ctcaccattc tgactaggca cgccctgctg
     1801 cacctgcagg tttaggttcg gacttttcta tttttactta cgttcacaaa tttcccgttg
     1861 ggcggacaat aaatgcattt cgttgagcaa tcaatgccct ctaaattaca atactgaaat
     1921 gtacttcagg gaattgtttt caatatattt tgaaaaaaat ttaaaaa