Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii translocase of inner membrane 9


LOCUS       XM_017160529             522 bp    mRNA    linear   INV 09-DEC-2024
            (Tim9a), mRNA.
ACCESSION   XM_017160529
VERSION     XM_017160529.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017160529.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..522
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..522
                     /gene="Tim9a"
                     /note="translocase of inner membrane 9; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 1 Protein"
                     /db_xref="GeneID:108070165"
     CDS             99..386
                     /gene="Tim9a"
                     /codon_start=1
                     /product="mitochondrial import inner membrane translocase
                     subunit Tim9"
                     /protein_id="XP_017016018.1"
                     /db_xref="GeneID:108070165"
                     /translation="MAKSPENIALDQLDKDQMKTFSDFLMSYNKLSEMCFTDCVRDFT
                     SRDVKDSEEKCSLNCMEKYLKMNQRVSQRFQEFQVIANENALAMAQKTGKL"
     misc_feature    147..326
                     /gene="Tim9a"
                     /note="Tim10/DDP family zinc finger; Region: zf-Tim10_DDP;
                     pfam02953"
                     /db_xref="CDD:460764"
     polyA_site      522
                     /gene="Tim9a"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tgttttacca cctctattct attatttaat ataggcacat tattattgcc ccttttccgt
       61 tcgtttggag aaacttgaat caaatatcgc cgcacaagat ggccaagagc cccgaaaaca
      121 tagcgctcga ccagctggac aaggaccaaa tgaagacgtt ttccgacttc ctgatgtcct
      181 acaacaagct ctccgagatg tgcttcacag actgcgtgcg cgacttcaca tcgcgggatg
      241 tcaaggattc cgaggaaaag tgctcgctga actgcatgga gaagtacctg aagatgaacc
      301 agcgggtctc gcagcgcttc caggagttcc aggtcatcgc caacgagaac gccctggcca
      361 tggcccaaaa gactggcaaa ctgtaggtgt tgttatagct gtaggatgtt attatcaatc
      421 ttaactagtt tagacaactg agatgatgca tttttcctgc atttgtcaaa atagctgagt
      481 aaagaaacgc gttgacggtg gcccgacgat tattgtctac ta