Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017160529 522 bp mRNA linear INV 09-DEC-2024 (Tim9a), mRNA. ACCESSION XM_017160529 VERSION XM_017160529.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017160529.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..522 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..522 /gene="Tim9a" /note="translocase of inner membrane 9; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108070165" CDS 99..386 /gene="Tim9a" /codon_start=1 /product="mitochondrial import inner membrane translocase subunit Tim9" /protein_id="XP_017016018.1" /db_xref="GeneID:108070165" /translation="MAKSPENIALDQLDKDQMKTFSDFLMSYNKLSEMCFTDCVRDFT SRDVKDSEEKCSLNCMEKYLKMNQRVSQRFQEFQVIANENALAMAQKTGKL" misc_feature 147..326 /gene="Tim9a" /note="Tim10/DDP family zinc finger; Region: zf-Tim10_DDP; pfam02953" /db_xref="CDD:460764" polyA_site 522 /gene="Tim9a" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tgttttacca cctctattct attatttaat ataggcacat tattattgcc ccttttccgt 61 tcgtttggag aaacttgaat caaatatcgc cgcacaagat ggccaagagc cccgaaaaca 121 tagcgctcga ccagctggac aaggaccaaa tgaagacgtt ttccgacttc ctgatgtcct 181 acaacaagct ctccgagatg tgcttcacag actgcgtgcg cgacttcaca tcgcgggatg 241 tcaaggattc cgaggaaaag tgctcgctga actgcatgga gaagtacctg aagatgaacc 301 agcgggtctc gcagcgcttc caggagttcc aggtcatcgc caacgagaac gccctggcca 361 tggcccaaaa gactggcaaa ctgtaggtgt tgttatagct gtaggatgtt attatcaatc 421 ttaactagtt tagacaactg agatgatgca tttttcctgc atttgtcaaa atagctgagt 481 aaagaaacgc gttgacggtg gcccgacgat tattgtctac ta