Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii inaF-A (inaF-A), mRNA.


LOCUS       XM_017160519             420 bp    mRNA    linear   INV 09-DEC-2024
ACCESSION   XM_017160519
VERSION     XM_017160519.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017160519.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..420
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..420
                     /gene="inaF-A"
                     /note="inaF-A; Derived by automated computational analysis
                     using gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 1 Protein"
                     /db_xref="GeneID:108070156"
     CDS             6..278
                     /gene="inaF-A"
                     /codon_start=1
                     /product="uncharacterized protein inaF-A"
                     /protein_id="XP_017016008.1"
                     /db_xref="GeneID:108070156"
                     /translation="MASAALNLGEKSEGSQDDVRLPQEQPPSPFFETKAFRLISIFLY
                     LGGISGLGMVLALYYLIFFDSSMPDIHLKFPVSIGGHPVQKVHEYQ"
     misc_feature    105..206
                     /gene="inaF-A"
                     /note="TRP-interacting helix; Region: InaF-motif;
                     pfam15018"
                     /db_xref="CDD:464449"
ORIGIN      
        1 taattatggc ctcagccgct ttgaatttgg gtgaaaagtc ggagggttcg caggacgacg
       61 ttcgcctgcc ccaggagcag cctccttcgc ccttcttcga aacgaaggcc ttccgcctga
      121 tctcgatatt cctgtatctg ggcgggatca gtggcctggg catggtgctg gccctgtact
      181 acctcatctt cttcgactcc agcatgccgg acatccacct caagttcccc gtctccattg
      241 gcggccatcc agtgcagaag gtgcacgagt accagtgacc atttgaccac ttgacccatc
      301 caggtgataa aattgtgata cccgaaaaaa tagccattcg cctcctaaac tcatcggaag
      361 tgaccgcgga gcagttctac aagcacatcc tcgagcagta ccgcatcctc agccacatgc