Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017160519 420 bp mRNA linear INV 09-DEC-2024 ACCESSION XM_017160519 VERSION XM_017160519.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017160519.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..420 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..420 /gene="inaF-A" /note="inaF-A; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108070156" CDS 6..278 /gene="inaF-A" /codon_start=1 /product="uncharacterized protein inaF-A" /protein_id="XP_017016008.1" /db_xref="GeneID:108070156" /translation="MASAALNLGEKSEGSQDDVRLPQEQPPSPFFETKAFRLISIFLY LGGISGLGMVLALYYLIFFDSSMPDIHLKFPVSIGGHPVQKVHEYQ" misc_feature 105..206 /gene="inaF-A" /note="TRP-interacting helix; Region: InaF-motif; pfam15018" /db_xref="CDD:464449" ORIGIN 1 taattatggc ctcagccgct ttgaatttgg gtgaaaagtc ggagggttcg caggacgacg 61 ttcgcctgcc ccaggagcag cctccttcgc ccttcttcga aacgaaggcc ttccgcctga 121 tctcgatatt cctgtatctg ggcgggatca gtggcctggg catggtgctg gccctgtact 181 acctcatctt cttcgactcc agcatgccgg acatccacct caagttcccc gtctccattg 241 gcggccatcc agtgcagaag gtgcacgagt accagtgacc atttgaccac ttgacccatc 301 caggtgataa aattgtgata cccgaaaaaa tagccattcg cctcctaaac tcatcggaag 361 tgaccgcgga gcagttctac aagcacatcc tcgagcagta ccgcatcctc agccacatgc