Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017160497 402 bp mRNA linear INV 09-DEC-2024 (LOC108070144), mRNA. ACCESSION XM_017160497 VERSION XM_017160497.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017160497.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..402 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..402 /gene="LOC108070144" /note="uncharacterized LOC108070144; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108070144" CDS 41..385 /gene="LOC108070144" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_017015986.2" /db_xref="GeneID:108070144" /translation="MSHFAAVAAALFVCLAVILGGQGSQAAIARVKLANPTHPGKCVL DSNTIMSPGQSGKAPNLPCARAECHDDGFVTIQTCAAVAPPKGCKQRDFVNLNRNYPE CCERSYDCSKHI" misc_feature 164..370 /gene="LOC108070144" /note="Single domain von Willebrand factor type C; Region: SVWC; pfam15430" /db_xref="CDD:464713" ORIGIN 1 gttttccgag atcacctcca aaaaacatcc attcaacaga atgtcgcact tcgccgctgt 61 cgccgccgcc ctcttcgtct gcctcgccgt catcctgggc ggccaaggat cccaggcggc 121 cattgcccga gtcaagctgg ccaatcccac tcatccgggc aagtgtgtgc tggactcgaa 181 caccatcatg tcgccgggac agagcggcaa ggcgcccaat ctgccctgcg cgagggccga 241 gtgccatgac gacggcttcg tgaccatcca gacctgcgcc gccgtcgctc cgcccaaggg 301 atgcaagcag cgcgacttcg tcaacctcaa ccgcaactat cccgagtgct gcgagcgatc 361 ctacgactgc tccaagcaca tctaggctat cagccgccaa ct