Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii uncharacterized protein


LOCUS       XM_017160497             402 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108070144), mRNA.
ACCESSION   XM_017160497
VERSION     XM_017160497.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017160497.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..402
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..402
                     /gene="LOC108070144"
                     /note="uncharacterized LOC108070144; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:108070144"
     CDS             41..385
                     /gene="LOC108070144"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_017015986.2"
                     /db_xref="GeneID:108070144"
                     /translation="MSHFAAVAAALFVCLAVILGGQGSQAAIARVKLANPTHPGKCVL
                     DSNTIMSPGQSGKAPNLPCARAECHDDGFVTIQTCAAVAPPKGCKQRDFVNLNRNYPE
                     CCERSYDCSKHI"
     misc_feature    164..370
                     /gene="LOC108070144"
                     /note="Single domain von Willebrand factor type C; Region:
                     SVWC; pfam15430"
                     /db_xref="CDD:464713"
ORIGIN      
        1 gttttccgag atcacctcca aaaaacatcc attcaacaga atgtcgcact tcgccgctgt
       61 cgccgccgcc ctcttcgtct gcctcgccgt catcctgggc ggccaaggat cccaggcggc
      121 cattgcccga gtcaagctgg ccaatcccac tcatccgggc aagtgtgtgc tggactcgaa
      181 caccatcatg tcgccgggac agagcggcaa ggcgcccaat ctgccctgcg cgagggccga
      241 gtgccatgac gacggcttcg tgaccatcca gacctgcgcc gccgtcgctc cgcccaaggg
      301 atgcaagcag cgcgacttcg tcaacctcaa ccgcaactat cccgagtgct gcgagcgatc
      361 ctacgactgc tccaagcaca tctaggctat cagccgccaa ct