Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii uncharacterized protein


LOCUS       XM_017160490             905 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108070141), transcript variant X1, mRNA.
ACCESSION   XM_017160490
VERSION     XM_017160490.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017160490.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..905
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..905
                     /gene="LOC108070141"
                     /note="uncharacterized LOC108070141; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:108070141"
     CDS             281..838
                     /gene="LOC108070141"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_017015979.2"
                     /db_xref="GeneID:108070141"
                     /translation="MSQVMQMTRHVTSWLGWTPASSCDGLPAAEEEDPIQESSGFVTV
                     LILYLGMAGFFAALNLFPRDKRERRQVQRLERQGRESSYSSLPLTWLVNLTSLICEVA
                     APRRPSVFLQQQRLRMRLLRQKEQELVMAAEWQELPTWQDVLDDEGEEKEEAEEEQVE
                     QPVAAICLMPKRQKSTYFDLPSESE"
     polyA_site      905
                     /gene="LOC108070141"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 gtcaggctgg gtttaaaaaa aaagagttct cactcagttc ctagcattaa ttccgactgg
       61 gcggacaagc ccgcacgaac acaaaaacat aaagcaccgt aaccgtagcc catgtagcaa
      121 tacccagcca tccaaaagaa tttggtaaat atcaacagca acattcgcac cacaggatag
      181 ccaggattta ctaggcagtt agcaggaaca agaagaattt ttgctaggaa ttgggaacca
      241 cagacaaccg ggaactgtat acaaatttaa cccatcaagg atgtcgcaag tgatgcagat
      301 gacccgccac gtgaccagct ggttgggctg gacaccggca tcttcgtgcg atggcctgcc
      361 ggcggcggag gaggaggacc ccatccagga gtcgtccggc tttgtcaccg tcctgattct
      421 ctacctgggc atggctggct tctttgcggc cctcaatctc tttccgcggg acaagcggga
      481 gcgacggcag gtgcagcggt tggagcggca gggcagggaa agtagttatt catccctgcc
      541 cctaacttgg ctggtcaacc tgacctcgct gatctgcgag gtggctgcgc ccaggcgtcc
      601 ttccgtcttt ttgcagcagc agcgattgcg gatgcgcctg ctccggcaga aggaacagga
      661 gcttgtgatg gcggccgagt ggcaggagct tcccacttgg caggatgtcc tcgatgatga
      721 aggggaggag aaggaggagg cggaggagga gcaggtggag cagccggtgg ctgccatctg
      781 tctcatgcca aagcgccaaa agtccaccta tttcgatctg ccctccgaat ccgaatagcc
      841 agaataacca ggcaaatcca aatcatattg tgagattcag aaaaaataaa atcccaataa
      901 ataag