Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii COMM domain containing 10 protein


LOCUS       XM_017160482             916 bp    mRNA    linear   INV 09-DEC-2024
            valette (Vlet), mRNA.
ACCESSION   XM_017160482
VERSION     XM_017160482.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017160482.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..916
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..916
                     /gene="Vlet"
                     /note="COMM domain containing 10 protein valette; Derived
                     by automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 3 Proteins"
                     /db_xref="GeneID:108070136"
     CDS             148..867
                     /gene="Vlet"
                     /codon_start=1
                     /product="COMM domain-containing protein 10"
                     /protein_id="XP_017015971.2"
                     /db_xref="GeneID:108070136"
                     /translation="MSINWIKITERAREGIKIINALPYETFTTVLWYTHRQMSPSGAS
                     GAAAPGATSCTVGTSVTTTGRADSSTEENPTSSSEPEYTLEELERLVGVPRPDFLLLI
                     KTFSYILRRISTFIIKPSLLQRELREKLQLEDEAKIDAILRLWVRETTPIMNNLASKR
                     YESNVIEDVAWKLNVEVSSHCQQREKTPLAVLQMKTGVGEDINIEMTHPELVELYNQF
                     ENIQGELDAMLAMKAPDAAAQ"
     misc_feature    181..831
                     /gene="Vlet"
                     /note="COMM_Domain containing protein 10. The COMM Domain
                     is found at the C-terminus of a variety of proteins;
                     presumably all COMM_Domain containing proteins are located
                     in the nucleus and the COMM domain plays a role in
                     protein-protein interactions. Several...; Region: Commd10;
                     cd04758"
                     /db_xref="CDD:240106"
     polyA_site      916
                     /gene="Vlet"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 gtttttgttg ctctctataa acaaagtcta catttgtttg ttatttatta taattaataa
       61 ataagcaaga ttcaaataag aaaaagataa tataagcgct tcatctagag atctatcgac
      121 tatatgtttc ttggaaatac gtgaatcatg agcattaact ggataaagat caccgaaaga
      181 gcccgcgagg gcatcaagat catcaacgcc ctgccctacg agaccttcac cacggttctg
      241 tggtacaccc accggcagat gagtcccagc ggagcctcgg gagcggcggc gccgggtgcc
      301 accagttgta cggtgggcac cagcgtgacg accaccggac gggcggacag cagcaccgag
      361 gagaacccca cgagcagctc ggagccggag tacacgctcg aggaactgga gcgactggtg
      421 ggcgtgccgc ggccggactt tctgctcctg atcaagacct tctcctacat cctgcgacgc
      481 atctccacgt tcatcatcaa gcccagcctg ctgcagcggg agctgcgcga gaagctccag
      541 ctggaggacg aggccaagat cgatgccatt ttgcggctgt gggtgcgcga gacgacgccc
      601 attatgaaca acttggccag caagcggtac gagtcgaatg tcattgagga tgtggcctgg
      661 aaactgaacg tggaggtctc ctcgcactgc cagcagcggg agaagacgcc gctggccgtg
      721 ctccaaatga agacgggcgt cggcgaggat atcaacatcg agatgacgca cccggaactt
      781 gtcgagctgt acaatcagtt cgagaacatc cagggcgaac tggacgccat gctggccatg
      841 aaggctccgg atgcagctgc tcagtagcgg gacaccgtcg acttctcagt gccaatttag
      901 ttgctagttc acacaa