Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017160458 558 bp mRNA linear INV 09-DEC-2024 mRNA. ACCESSION XM_017160458 VERSION XM_017160458.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017160458.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..558 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..558 /gene="RPA3" /note="Replication protein A3; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108070121" CDS 84..422 /gene="RPA3" /codon_start=1 /product="uncharacterized protein RPA3" /protein_id="XP_017015947.1" /db_xref="GeneID:108070121" /translation="MDAFDPRSIINGGMLKQFSGQTVSIMVRVESVAGSTLLANSTDN HKLKINLPGELGAADGAWVEVIGVPHGADTIRAKEVIEFGGENIDFDKDGYNGLSHLI NNVKAFYRSG" misc_feature 84..410 /gene="RPA3" /note="Replication factor A protein 3; Region: Rep_fac-A_3; pfam08661" /db_xref="CDD:462551" polyA_site 558 /gene="RPA3" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tcttgattgg cgctctttct tgtttacggc atttcatttt ctgctgaaac tcgaaacttt 61 tctgataaaa ctactggaaa atcatggacg cctttgatcc tcgctcgatt atcaacgggg 121 gaatgctgaa gcagttctcc ggacagaccg tgagcatcat ggttcgcgtg gagagcgtgg 181 cgggatccac tttgctggcc aactcgacgg acaaccataa gctgaagatc aatctgccgg 241 gcgaactggg cgccgccgat ggagcctggg tggaggtcat tggagtgccc catggcgcgg 301 acaccatcag ggccaaggag gtcatcgaat tcggcggcga gaacatcgat ttcgataagg 361 atggctacaa tggcttgagc cacctgatca acaatgtgaa ggccttctat cgcagcggct 421 aggggtgcat catcccctaa ttcctatatt tagaaataag aattatttgt accttaatct 481 aagtttatcc atttttttgc ggagtgcact tgaaaaaccc atctgcgggc tgaaataaac 541 ttgaaatatt cggtaaaa