Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii Replication protein A3 (RPA3),


LOCUS       XM_017160458             558 bp    mRNA    linear   INV 09-DEC-2024
            mRNA.
ACCESSION   XM_017160458
VERSION     XM_017160458.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017160458.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..558
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..558
                     /gene="RPA3"
                     /note="Replication protein A3; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:108070121"
     CDS             84..422
                     /gene="RPA3"
                     /codon_start=1
                     /product="uncharacterized protein RPA3"
                     /protein_id="XP_017015947.1"
                     /db_xref="GeneID:108070121"
                     /translation="MDAFDPRSIINGGMLKQFSGQTVSIMVRVESVAGSTLLANSTDN
                     HKLKINLPGELGAADGAWVEVIGVPHGADTIRAKEVIEFGGENIDFDKDGYNGLSHLI
                     NNVKAFYRSG"
     misc_feature    84..410
                     /gene="RPA3"
                     /note="Replication factor A protein 3; Region:
                     Rep_fac-A_3; pfam08661"
                     /db_xref="CDD:462551"
     polyA_site      558
                     /gene="RPA3"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tcttgattgg cgctctttct tgtttacggc atttcatttt ctgctgaaac tcgaaacttt
       61 tctgataaaa ctactggaaa atcatggacg cctttgatcc tcgctcgatt atcaacgggg
      121 gaatgctgaa gcagttctcc ggacagaccg tgagcatcat ggttcgcgtg gagagcgtgg
      181 cgggatccac tttgctggcc aactcgacgg acaaccataa gctgaagatc aatctgccgg
      241 gcgaactggg cgccgccgat ggagcctggg tggaggtcat tggagtgccc catggcgcgg
      301 acaccatcag ggccaaggag gtcatcgaat tcggcggcga gaacatcgat ttcgataagg
      361 atggctacaa tggcttgagc cacctgatca acaatgtgaa ggccttctat cgcagcggct
      421 aggggtgcat catcccctaa ttcctatatt tagaaataag aattatttgt accttaatct
      481 aagtttatcc atttttttgc ggagtgcact tgaaaaaccc atctgcgggc tgaaataaac
      541 ttgaaatatt cggtaaaa