Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii Bprotein-1-related complex subunit


LOCUS       XM_017160457             675 bp    mRNA    linear   INV 09-DEC-2024
            8 homolog (LOC108070119), mRNA.
ACCESSION   XM_017160457
VERSION     XM_017160457.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017160457.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..675
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..675
                     /gene="LOC108070119"
                     /note="BLOC-1-related complex subunit 8 homolog; Derived
                     by automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 1 Protein"
                     /db_xref="GeneID:108070119"
     CDS             52..603
                     /gene="LOC108070119"
                     /codon_start=1
                     /product="BLOC-1-related complex subunit 8 homolog"
                     /protein_id="XP_017015946.1"
                     /db_xref="GeneID:108070119"
                     /translation="MSRGGELVFKTKKTSEKISENIHIFANDPSLAFFRVQEHVRKVS
                     PAIFEKRDEVFQLQNNLQGHCYDMEYGIQALRTIEKSESIFDNIQEMIKASIFLKQQL
                     KYEENRKKIKKESTKSSVYKRFSAHLALDLPDLPDFGGVMRETSQRMENMIGPGTGTG
                     RTEAQAPPASNPGELQRSYTTLH"
     misc_feature    76..396
                     /gene="LOC108070119"
                     /note="BLOC-1-related complex sub-unit 8; Region: BORCS8;
                     pfam10167"
                     /db_xref="CDD:462974"
     polyA_site      675
                     /gene="LOC108070119"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 cttttccaag actagatgta aacaaaaaga agagtaaaag taaataaaac aatgtctcgg
       61 ggcggagaac tggtctttaa aacgaagaaa acctcggaga agatatcgga aaacatacac
      121 atcttcgcca acgatccgtc gctggccttt ttccgggtcc aagaacacgt tcgcaaggtt
      181 tcgccagcga ttttcgagaa gcgcgatgag gtcttccagc tgcaaaacaa tctccagggg
      241 cattgttacg atatggagta cggaattcaa gccctgcgta cgattgaaaa atcggagagc
      301 atattcgaca acatacagga aatgatcaag gcttcgattt tcctgaagca acagctgaaa
      361 tacgaggaaa acaggaagaa gatcaagaag gagagcacca aatcttcggt ttacaagcga
      421 ttctccgccc acctcgcttt ggatctgccg gatttacccg attttggtgg cgttatgcgg
      481 gaaaccagcc agcgaatgga gaatatgata ggtcctggca cgggaacagg acgaactgag
      541 gcccaggccc cgccagccag caatccgggg gaactccaga gatcctacac cacactccac
      601 tagttagcct taagttttag tcttgtaatt gtagctatgt gtgtgattat cgcaaaataa
      661 attatatttc aatta