Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017160457 675 bp mRNA linear INV 09-DEC-2024 8 homolog (LOC108070119), mRNA. ACCESSION XM_017160457 VERSION XM_017160457.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017160457.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..675 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..675 /gene="LOC108070119" /note="BLOC-1-related complex subunit 8 homolog; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108070119" CDS 52..603 /gene="LOC108070119" /codon_start=1 /product="BLOC-1-related complex subunit 8 homolog" /protein_id="XP_017015946.1" /db_xref="GeneID:108070119" /translation="MSRGGELVFKTKKTSEKISENIHIFANDPSLAFFRVQEHVRKVS PAIFEKRDEVFQLQNNLQGHCYDMEYGIQALRTIEKSESIFDNIQEMIKASIFLKQQL KYEENRKKIKKESTKSSVYKRFSAHLALDLPDLPDFGGVMRETSQRMENMIGPGTGTG RTEAQAPPASNPGELQRSYTTLH" misc_feature 76..396 /gene="LOC108070119" /note="BLOC-1-related complex sub-unit 8; Region: BORCS8; pfam10167" /db_xref="CDD:462974" polyA_site 675 /gene="LOC108070119" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 cttttccaag actagatgta aacaaaaaga agagtaaaag taaataaaac aatgtctcgg 61 ggcggagaac tggtctttaa aacgaagaaa acctcggaga agatatcgga aaacatacac 121 atcttcgcca acgatccgtc gctggccttt ttccgggtcc aagaacacgt tcgcaaggtt 181 tcgccagcga ttttcgagaa gcgcgatgag gtcttccagc tgcaaaacaa tctccagggg 241 cattgttacg atatggagta cggaattcaa gccctgcgta cgattgaaaa atcggagagc 301 atattcgaca acatacagga aatgatcaag gcttcgattt tcctgaagca acagctgaaa 361 tacgaggaaa acaggaagaa gatcaagaag gagagcacca aatcttcggt ttacaagcga 421 ttctccgccc acctcgcttt ggatctgccg gatttacccg attttggtgg cgttatgcgg 481 gaaaccagcc agcgaatgga gaatatgata ggtcctggca cgggaacagg acgaactgag 541 gcccaggccc cgccagccag caatccgggg gaactccaga gatcctacac cacactccac 601 tagttagcct taagttttag tcttgtaatt gtagctatgt gtgtgattat cgcaaaataa 661 attatatttc aatta