Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017160455 886 bp mRNA linear INV 09-DEC-2024 (LOC108070117), mRNA. ACCESSION XM_017160455 VERSION XM_017160455.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017160455.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..886 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..886 /gene="LOC108070117" /note="uncharacterized LOC108070117; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108070117" CDS 33..533 /gene="LOC108070117" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_017015944.2" /db_xref="GeneID:108070117" /translation="MANGSVQSLRVLPVWVPQWAMALLWALLWNRKRFSRLFMRVRVW RAGQFTSATDRKMTLPVQPPKWILLMAILVLLGFSRLASASAKPQQFLLAEDLVTGTG TASGTGTGTGTGTATGNAADPLNDPSDLSAGLNFAPVGNLIAAAANAVPPAPIQFIRT AMNSGL" ORIGIN 1 gcccgtaatt tatgagcggc cactgaactt aaatggcaaa tggcagcgtg caaagcttac 61 gggttttacc agtttgggtg cctcagtggg ccatggcttt gctttgggct ttgctttgga 121 atcggaaaag gttttcgaga cttttcatgc gagtgcgcgt ttggcgagcg ggtcagttca 181 cgtccgccac tgatcgcaag atgacgctcc cggtgcagcc acccaagtgg atattactga 241 tggcaatcct ggtgctcctg ggcttcagcc gcctggcctc agcctcggcc aaaccgcagc 301 agtttctgct ggccgaggat ttggtaacgg gaacgggcac ggcttccgga actggaacag 361 gaaccggaac tggaactgca accggaaatg cagctgatcc ccttaacgat ccttcggatc 421 taagtgctgg tctcaatttc gcccccgttg gcaatctgat tgcggcagct gcgaatgccg 481 taccccctgc ccccattcaa tttattcgca cggccatgaa cagcgggctc tgaccgccag 541 gtggcgctaa cctggattct tggccacccc aaaattaatt gtctctaatt ttgaagcgcc 601 tttttaagca ccacttttaa ttactttgtt aagcgtttat ttttttttgg cgattttttt 661 tgttttgttt ttggaagtaa gcttgttttg tttttgtttg ttgtctttat gtgtgtttgt 721 gctgagctaa gtggctatat aaatgacttt atgatacttg ttctatctgg ttatgacttt 781 ttggagcgat aaaaagtgtg caattggggg cctcagcctc aaaagctatt cttgttatct 841 ggatctgtta tcggggaatt ctctattcta tatctttcac tttttt