Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii uncharacterized protein


LOCUS       XM_017160455             886 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108070117), mRNA.
ACCESSION   XM_017160455
VERSION     XM_017160455.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017160455.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..886
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..886
                     /gene="LOC108070117"
                     /note="uncharacterized LOC108070117; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:108070117"
     CDS             33..533
                     /gene="LOC108070117"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_017015944.2"
                     /db_xref="GeneID:108070117"
                     /translation="MANGSVQSLRVLPVWVPQWAMALLWALLWNRKRFSRLFMRVRVW
                     RAGQFTSATDRKMTLPVQPPKWILLMAILVLLGFSRLASASAKPQQFLLAEDLVTGTG
                     TASGTGTGTGTGTATGNAADPLNDPSDLSAGLNFAPVGNLIAAAANAVPPAPIQFIRT
                     AMNSGL"
ORIGIN      
        1 gcccgtaatt tatgagcggc cactgaactt aaatggcaaa tggcagcgtg caaagcttac
       61 gggttttacc agtttgggtg cctcagtggg ccatggcttt gctttgggct ttgctttgga
      121 atcggaaaag gttttcgaga cttttcatgc gagtgcgcgt ttggcgagcg ggtcagttca
      181 cgtccgccac tgatcgcaag atgacgctcc cggtgcagcc acccaagtgg atattactga
      241 tggcaatcct ggtgctcctg ggcttcagcc gcctggcctc agcctcggcc aaaccgcagc
      301 agtttctgct ggccgaggat ttggtaacgg gaacgggcac ggcttccgga actggaacag
      361 gaaccggaac tggaactgca accggaaatg cagctgatcc ccttaacgat ccttcggatc
      421 taagtgctgg tctcaatttc gcccccgttg gcaatctgat tgcggcagct gcgaatgccg
      481 taccccctgc ccccattcaa tttattcgca cggccatgaa cagcgggctc tgaccgccag
      541 gtggcgctaa cctggattct tggccacccc aaaattaatt gtctctaatt ttgaagcgcc
      601 tttttaagca ccacttttaa ttactttgtt aagcgtttat ttttttttgg cgattttttt
      661 tgttttgttt ttggaagtaa gcttgttttg tttttgtttg ttgtctttat gtgtgtttgt
      721 gctgagctaa gtggctatat aaatgacttt atgatacttg ttctatctgg ttatgacttt
      781 ttggagcgat aaaaagtgtg caattggggg cctcagcctc aaaagctatt cttgttatct
      841 ggatctgtta tcggggaatt ctctattcta tatctttcac tttttt