Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii lipocalin/cytosolic fatty


LOCUS       XM_017160432             995 bp    mRNA    linear   INV 09-DEC-2024
            acid-binding protein Karl (Karl), mRNA.
ACCESSION   XM_017160432
VERSION     XM_017160432.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017160432.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..995
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..995
                     /gene="Karl"
                     /note="lipocalin/cytosolic fatty acid-binding protein
                     Karl; Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 4 Proteins"
                     /db_xref="GeneID:108070101"
     CDS             96..839
                     /gene="Karl"
                     /codon_start=1
                     /product="uncharacterized protein Karl"
                     /protein_id="XP_017015921.3"
                     /db_xref="GeneID:108070101"
                     /translation="MAPPIMGRNGVILLFASLIIILEIFTPVDGNLWTRHNSNAYQTR
                     RRSGPSNQCPKVGAIKNFDLERMMGCWHVVQYYASTEELPEYACMRSHFSFSKEDQHI
                     TMNFSYIFAEDPLREKLVGNITWMIPKFDEPGHWQHTEDIYEGIYNTYVLDTDYDTWG
                     LVMHCAEKKKQPRYLSALLLARKPALADNEISFLRGKLPQDIDASFMFDIGQESCDHL
                     MESSRDDPLAYVVNGRQNAKEIFKIVNKL"
     misc_feature    291..641
                     /gene="Karl"
                     /note="lipocalin/cytosolic fatty acid-binding protein
                     family; Region: lipocalin_FABP; cd00301"
                     /db_xref="CDD:381182"
     misc_feature    order(294..296,306..308,366..368,372..374,405..407,
                     411..413,417..419,462..464,468..470,474..476,501..503,
                     507..509,534..536,540..542,546..548,573..575,579..581,
                     585..587,621..623,627..629,633..635)
                     /gene="Karl"
                     /note="ligand binding cavity [chemical binding]; other
                     site"
                     /db_xref="CDD:381182"
ORIGIN      
        1 aacagtgcca gcgacaacgc aacggagatc gcgcgtctga gcccgccgga agattaacga
       61 caataagcca ttaatagccc ccctgatccg gaataatggc ccccccgatc atgggcagga
      121 atggagtgat cctgcttttc gcctctttaa taattatcct ggaaattttc accccggtgg
      181 atggcaatct gtggacgagg cacaatagca atgcatatca aacgaggagg cgatcaggtc
      241 caagtaacca gtgtcccaag gttggcgcta taaagaactt tgatttggaa cggatgatgg
      301 gctgctggca cgtggttcag tattatgctt ccacggagga gctgcccgaa tacgcttgca
      361 tgcgcagtca cttttccttc tccaaggaag atcaacatat aacgatgaac tttagctata
      421 tattcgcgga ggatccgttg cgtgaaaagc ttgtaggcaa catcacctgg atgataccca
      481 agttcgatga gccaggacat tggcagcaca cggaggatat atatgagggc atctacaaca
      541 cgtacgtcct ggacacggat tacgacacct ggggcctggt gatgcactgc gccgagaaga
      601 agaagcagcc gcgctacctg tccgccctgc ttttggcccg gaaaccggct ctggccgaca
      661 acgagattag cttcctgcgc ggcaagttgc cgcaggacat cgacgcatcc tttatgttcg
      721 acatcggaca ggagtcctgc gaccacctga tggaatcgag tcgcgacgat ccgctggcct
      781 atgtggtgaa cggtcgccag aatgccaagg aaatattcaa gattgtcaat aagctgtgat
      841 tgtgaaacta tccacacaac taaagacgta ttaatatgtg tactatttca ataaactttt
      901 caataaatga ttattttaat ataattattt gatatgatta ataaaaatag taaagaaaaa
      961 agtatatttt aaacttacgc gccttacata tatat