Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017160432 995 bp mRNA linear INV 09-DEC-2024 acid-binding protein Karl (Karl), mRNA. ACCESSION XM_017160432 VERSION XM_017160432.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017160432.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..995 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..995 /gene="Karl" /note="lipocalin/cytosolic fatty acid-binding protein Karl; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 Proteins" /db_xref="GeneID:108070101" CDS 96..839 /gene="Karl" /codon_start=1 /product="uncharacterized protein Karl" /protein_id="XP_017015921.3" /db_xref="GeneID:108070101" /translation="MAPPIMGRNGVILLFASLIIILEIFTPVDGNLWTRHNSNAYQTR RRSGPSNQCPKVGAIKNFDLERMMGCWHVVQYYASTEELPEYACMRSHFSFSKEDQHI TMNFSYIFAEDPLREKLVGNITWMIPKFDEPGHWQHTEDIYEGIYNTYVLDTDYDTWG LVMHCAEKKKQPRYLSALLLARKPALADNEISFLRGKLPQDIDASFMFDIGQESCDHL MESSRDDPLAYVVNGRQNAKEIFKIVNKL" misc_feature 291..641 /gene="Karl" /note="lipocalin/cytosolic fatty acid-binding protein family; Region: lipocalin_FABP; cd00301" /db_xref="CDD:381182" misc_feature order(294..296,306..308,366..368,372..374,405..407, 411..413,417..419,462..464,468..470,474..476,501..503, 507..509,534..536,540..542,546..548,573..575,579..581, 585..587,621..623,627..629,633..635) /gene="Karl" /note="ligand binding cavity [chemical binding]; other site" /db_xref="CDD:381182" ORIGIN 1 aacagtgcca gcgacaacgc aacggagatc gcgcgtctga gcccgccgga agattaacga 61 caataagcca ttaatagccc ccctgatccg gaataatggc ccccccgatc atgggcagga 121 atggagtgat cctgcttttc gcctctttaa taattatcct ggaaattttc accccggtgg 181 atggcaatct gtggacgagg cacaatagca atgcatatca aacgaggagg cgatcaggtc 241 caagtaacca gtgtcccaag gttggcgcta taaagaactt tgatttggaa cggatgatgg 301 gctgctggca cgtggttcag tattatgctt ccacggagga gctgcccgaa tacgcttgca 361 tgcgcagtca cttttccttc tccaaggaag atcaacatat aacgatgaac tttagctata 421 tattcgcgga ggatccgttg cgtgaaaagc ttgtaggcaa catcacctgg atgataccca 481 agttcgatga gccaggacat tggcagcaca cggaggatat atatgagggc atctacaaca 541 cgtacgtcct ggacacggat tacgacacct ggggcctggt gatgcactgc gccgagaaga 601 agaagcagcc gcgctacctg tccgccctgc ttttggcccg gaaaccggct ctggccgaca 661 acgagattag cttcctgcgc ggcaagttgc cgcaggacat cgacgcatcc tttatgttcg 721 acatcggaca ggagtcctgc gaccacctga tggaatcgag tcgcgacgat ccgctggcct 781 atgtggtgaa cggtcgccag aatgccaagg aaatattcaa gattgtcaat aagctgtgat 841 tgtgaaacta tccacacaac taaagacgta ttaatatgtg tactatttca ataaactttt 901 caataaatga ttattttaat ataattattt gatatgatta ataaaaatag taaagaaaaa 961 agtatatttt aaacttacgc gccttacata tatat