Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii Glutaredoxin 5 (Grx5), mRNA.


LOCUS       XM_017160430             691 bp    mRNA    linear   INV 09-DEC-2024
ACCESSION   XM_017160430
VERSION     XM_017160430.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017160430.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..691
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..691
                     /gene="Grx5"
                     /note="Glutaredoxin 5; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 1 Protein"
                     /db_xref="GeneID:108070099"
     CDS             99..593
                     /gene="Grx5"
                     /codon_start=1
                     /product="uncharacterized monothiol glutaredoxin
                     ycf64-like"
                     /protein_id="XP_017015919.2"
                     /db_xref="GeneID:108070099"
                     /translation="MNRICQSLLRPSYRMAAGAGASASTPGVLSRLFAGDAATGAAVD
                     KATLDKLVRTNKVVVFMKGNPQAPRCGFSNAVVQIMRMHGVQYDAHDVLQNESLRQGV
                     KDYTDWPTIPQVFIDGEFVGGCDILLQMHQSGDLIEELKKVGIESELLKAEQAKQEDE
                     KKDK"
     misc_feature    240..506
                     /gene="Grx5"
                     /note="Glutaredoxin (GRX) family, PKC-interacting cousin
                     of TRX (PICOT)-like subfamily; composed of PICOT and
                     GRX-PICOT-like proteins. The non-PICOT members of this
                     family contain only the GRX-like domain, whereas PICOT
                     contains an N-terminal TRX-like domain...; Region:
                     GRX_PICOT_like; cd03028"
                     /db_xref="CDD:239326"
     misc_feature    order(282..284,306..314,426..431)
                     /gene="Grx5"
                     /note="putative GSH binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:239326"
     misc_feature    order(306..308,315..317)
                     /gene="Grx5"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:239326"
     polyA_site      691
                     /gene="Grx5"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tcgctattcg atacctttca gccgacactt gacagccctt gttgttatta gataatatta
       61 ttaatattat tattacctcg aggagagcgc cgccgaagat gaaccgaatt tgccagagcc
      121 tgttgcgtcc gagctaccgg atggccgccg gagccggagc aagtgcatcc accccgggcg
      181 ttctgagtcg cctctttgcc ggcgatgcgg cgaccggcgc ggcggtggac aaggcgacgc
      241 tggacaagct ggtgcgcacc aacaaggtgg tcgtcttcat gaagggcaat ccccaggcgc
      301 cgcgctgcgg cttcagcaat gcggtggtgc agatcatgcg gatgcacggc gtccagtacg
      361 atgcccacga tgtcctgcag aacgagtcgc tgcggcaggg ggtaaaggac tacaccgact
      421 ggccaaccat tccgcaggtc ttcatcgatg gcgagttcgt cggcggctgc gacatcctgc
      481 tgcagatgca ccagagtggc gacctcatcg aggagctcaa gaaggtgggc atcgagtccg
      541 agctgctgaa ggcggagcag gctaagcagg aggacgagaa gaaggacaag tgatgccccc
      601 cacagagcac ccaaagatca aaccccccca aaaaacctaa atgttagcca cgcaacgttt
      661 ttattattaa atgtttaact cataatgaca a