Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017160430 691 bp mRNA linear INV 09-DEC-2024 ACCESSION XM_017160430 VERSION XM_017160430.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017160430.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..691 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..691 /gene="Grx5" /note="Glutaredoxin 5; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108070099" CDS 99..593 /gene="Grx5" /codon_start=1 /product="uncharacterized monothiol glutaredoxin ycf64-like" /protein_id="XP_017015919.2" /db_xref="GeneID:108070099" /translation="MNRICQSLLRPSYRMAAGAGASASTPGVLSRLFAGDAATGAAVD KATLDKLVRTNKVVVFMKGNPQAPRCGFSNAVVQIMRMHGVQYDAHDVLQNESLRQGV KDYTDWPTIPQVFIDGEFVGGCDILLQMHQSGDLIEELKKVGIESELLKAEQAKQEDE KKDK" misc_feature 240..506 /gene="Grx5" /note="Glutaredoxin (GRX) family, PKC-interacting cousin of TRX (PICOT)-like subfamily; composed of PICOT and GRX-PICOT-like proteins. The non-PICOT members of this family contain only the GRX-like domain, whereas PICOT contains an N-terminal TRX-like domain...; Region: GRX_PICOT_like; cd03028" /db_xref="CDD:239326" misc_feature order(282..284,306..314,426..431) /gene="Grx5" /note="putative GSH binding site [chemical binding]; other site" /db_xref="CDD:239326" misc_feature order(306..308,315..317) /gene="Grx5" /note="catalytic residues [active]" /db_xref="CDD:239326" polyA_site 691 /gene="Grx5" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tcgctattcg atacctttca gccgacactt gacagccctt gttgttatta gataatatta 61 ttaatattat tattacctcg aggagagcgc cgccgaagat gaaccgaatt tgccagagcc 121 tgttgcgtcc gagctaccgg atggccgccg gagccggagc aagtgcatcc accccgggcg 181 ttctgagtcg cctctttgcc ggcgatgcgg cgaccggcgc ggcggtggac aaggcgacgc 241 tggacaagct ggtgcgcacc aacaaggtgg tcgtcttcat gaagggcaat ccccaggcgc 301 cgcgctgcgg cttcagcaat gcggtggtgc agatcatgcg gatgcacggc gtccagtacg 361 atgcccacga tgtcctgcag aacgagtcgc tgcggcaggg ggtaaaggac tacaccgact 421 ggccaaccat tccgcaggtc ttcatcgatg gcgagttcgt cggcggctgc gacatcctgc 481 tgcagatgca ccagagtggc gacctcatcg aggagctcaa gaaggtgggc atcgagtccg 541 agctgctgaa ggcggagcag gctaagcagg aggacgagaa gaaggacaag tgatgccccc 601 cacagagcac ccaaagatca aaccccccca aaaaacctaa atgttagcca cgcaacgttt 661 ttattattaa atgtttaact cataatgaca a