Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017159984 892 bp mRNA linear INV 09-DEC-2024 ACCESSION XM_017159984 VERSION XM_017159984.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017159984.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..892 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..892 /gene="tsg" /note="twisted gastrulation; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:108069744" CDS 1..774 /gene="tsg" /codon_start=1 /product="protein twisted gastrulation" /protein_id="XP_017015473.2" /db_xref="GeneID:108069744" /translation="MRNVSLGREFLTRMQLLLSNSLCLLLLILSLNLAPRPSLANDDG CNEVVCGSVVSKCLITQSCQCKLNDSHCFKDCLNCLGELFVECCGCLDMCPKHKDVLP SLTPRSEIGDIEGLPELFDTLTAEDDEGWSTIRFPMRAGFKQRVQGGGSSSSDTGNGS GNGGSVQCTVIYVNSCIRSNKCRQQCESMGASSYRWFHDGCCECVGGDCLNYGINESR CRGCPDDQDQEAEQDLERFFGSEELDEDGWSYGEDDEFS" misc_feature 307..669 /gene="tsg" /note="Twisted gastrulation (Tsg) protein conserved region; Region: Tsg; pfam04668" /db_xref="CDD:461385" ORIGIN 1 atgcgtaatg tgtcattagg ccgcgagttc ttgaccagaa tgcagctgct cctgtccaac 61 tccctttgcc tgctgctgct gatcctgagc ctgaacctgg ctcctcggcc atcgctggcc 121 aacgatgatg ggtgcaacga ggtggtctgc ggatcggtgg tctccaagtg cctgatcacc 181 caaagctgcc agtgcaagtt gaacgacagc cattgcttca aggactgcct gaattgcttg 241 ggcgagctgt ttgtcgagtg ttgtggctgc ttggacatgt gtcccaagca caaggatgtc 301 ctgccctcgc tgacgccgcg ctcggagatt ggggatattg agggactgcc ggagttattt 361 gacaccttga cagccgagga tgacgaggga tggtcgacta tacggtttcc catgcgagct 421 ggcttcaagc agcgggttca gggaggaggc tccagctcct ctgacaccgg aaacggaagc 481 ggaaatggtg gctccgtcca gtgcaccgtg atatatgtga actcgtgcat ccggtcgaac 541 aagtgccggc agcagtgcga gagcatgggc gcgagcagct atcggtggtt ccacgacgga 601 tgctgcgagt gcgtgggcgg cgactgcctg aactatggga tcaatgagag tcgctgccgc 661 ggctgtccgg atgatcagga ccaggaggcc gagcaggatc tggagcgctt ctttggcagc 721 gaggagctcg acgaggacgg ttggagctac ggcgaggatg atgagttctc ctaacccctc 781 ttaacaaatt aaatgttcac ccatttgcta aatacacttg taaaataacc aatggcttgg 841 tagtttttag tttatttgat aataaaataa ataaagttga gaagtatttt ta