Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii twisted gastrulation (tsg), mRNA.


LOCUS       XM_017159984             892 bp    mRNA    linear   INV 09-DEC-2024
ACCESSION   XM_017159984
VERSION     XM_017159984.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017159984.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..892
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..892
                     /gene="tsg"
                     /note="twisted gastrulation; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 2
                     Proteins"
                     /db_xref="GeneID:108069744"
     CDS             1..774
                     /gene="tsg"
                     /codon_start=1
                     /product="protein twisted gastrulation"
                     /protein_id="XP_017015473.2"
                     /db_xref="GeneID:108069744"
                     /translation="MRNVSLGREFLTRMQLLLSNSLCLLLLILSLNLAPRPSLANDDG
                     CNEVVCGSVVSKCLITQSCQCKLNDSHCFKDCLNCLGELFVECCGCLDMCPKHKDVLP
                     SLTPRSEIGDIEGLPELFDTLTAEDDEGWSTIRFPMRAGFKQRVQGGGSSSSDTGNGS
                     GNGGSVQCTVIYVNSCIRSNKCRQQCESMGASSYRWFHDGCCECVGGDCLNYGINESR
                     CRGCPDDQDQEAEQDLERFFGSEELDEDGWSYGEDDEFS"
     misc_feature    307..669
                     /gene="tsg"
                     /note="Twisted gastrulation (Tsg) protein conserved
                     region; Region: Tsg; pfam04668"
                     /db_xref="CDD:461385"
ORIGIN      
        1 atgcgtaatg tgtcattagg ccgcgagttc ttgaccagaa tgcagctgct cctgtccaac
       61 tccctttgcc tgctgctgct gatcctgagc ctgaacctgg ctcctcggcc atcgctggcc
      121 aacgatgatg ggtgcaacga ggtggtctgc ggatcggtgg tctccaagtg cctgatcacc
      181 caaagctgcc agtgcaagtt gaacgacagc cattgcttca aggactgcct gaattgcttg
      241 ggcgagctgt ttgtcgagtg ttgtggctgc ttggacatgt gtcccaagca caaggatgtc
      301 ctgccctcgc tgacgccgcg ctcggagatt ggggatattg agggactgcc ggagttattt
      361 gacaccttga cagccgagga tgacgaggga tggtcgacta tacggtttcc catgcgagct
      421 ggcttcaagc agcgggttca gggaggaggc tccagctcct ctgacaccgg aaacggaagc
      481 ggaaatggtg gctccgtcca gtgcaccgtg atatatgtga actcgtgcat ccggtcgaac
      541 aagtgccggc agcagtgcga gagcatgggc gcgagcagct atcggtggtt ccacgacgga
      601 tgctgcgagt gcgtgggcgg cgactgcctg aactatggga tcaatgagag tcgctgccgc
      661 ggctgtccgg atgatcagga ccaggaggcc gagcaggatc tggagcgctt ctttggcagc
      721 gaggagctcg acgaggacgg ttggagctac ggcgaggatg atgagttctc ctaacccctc
      781 ttaacaaatt aaatgttcac ccatttgcta aatacacttg taaaataacc aatggcttgg
      841 tagtttttag tttatttgat aataaaataa ataaagttga gaagtatttt ta