Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017159974 1785 bp mRNA linear INV 09-DEC-2024 transcript variant X1, mRNA. ACCESSION XM_017159974 VERSION XM_017159974.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017159974.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1785 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1785 /gene="gd" /note="gastrulation-defective; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 Proteins" /db_xref="GeneID:108069739" CDS 157..1785 /gene="gd" /codon_start=1 /product="serine protease gd" /protein_id="XP_017015463.1" /db_xref="GeneID:108069739" /translation="MRLPLTALCICILILCIELVSKAVAQGMPVSPCPKIFQYRFDGS EWFGLMAVRSPDGHQPLHIRVTLSMRGKPTTNYLGEIELLTRGKFAHNAPVLYKIRFP KHHFPPKLLLLSANNHVICFGSGEHSIFMTQIQLEHIRKLAFIPDKISSLLLDPHEQG EGEEADTKAEEEAKKTHIQFKKKPFVQALKDICGRIDRDLDFRLSQKRDQEGEQEQES EPILGSEAITSPVFVEDNDGEDAHGLEHFVDETEEEENESLDDSASLPSITRGSWPWL AAIYVNNLTSLDFQCGGTLVSGRVVISSAHCFKLFNKRFTSNEVLVFLGRHNLKNWNE EGSLAAPVDGIYIHPDFNSQLSSYDADIAVIMLKDEVRFNTFIRPACLWSGSSKAEYI VGEQGIVIGWSFDRANRTQDQKLSPVALGGKKSSDSHSAPKVVKAPVVGNAECFRANA HFRSLSSNRTFCAGIHTEERDRHQQISASIYTGISGAGLFIRRNNRWMLRGTVSAALP AVESPEPGYVCCRSQYIIYADVAKFLDWITAFVI" misc_feature 247..531 /gene="gd" /note="Serine protease gd N-terminus; Region: GD_N; pfam16030" /db_xref="CDD:464985" misc_feature 958..1767 /gene="gd" /note="Trypsin-like serine protease; Many of these are synthesized as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms. Alignment contains also inactive enzymes that have substitutions of the catalytic triad...; Region: Tryp_SPc; cd00190" /db_xref="CDD:238113" misc_feature order(1072..1074,1237..1239,1609..1611) /gene="gd" /note="active site" /db_xref="CDD:238113" misc_feature order(1567..1569,1666..1668,1702..1704) /gene="gd" /note="substrate binding sites [chemical binding]; other site" /db_xref="CDD:238113" ORIGIN 1 tattgtttca aattcgacaa aattaccata attattactt attcgatttg tttgtttcgt 61 tttgcatagc tgaattgcag tagtgacacc ttcagatcga gatccagctc ctgatcagac 121 cagaaacacc ccgtcgcatc ccgtcccgac attgagatgc ggctgcccct gacggcgctc 181 tgcatctgca ttctgatcct ctgcatcgag ctcgtgtcca aggcggtcgc ccaggggatg 241 cccgtcagtc cgtgtcccaa gatattccag taccgcttcg acggcagcga gtggttcggc 301 ctgatggccg tgcgcagtcc ggatggccac cagccgctcc acatccgggt gacgctctcc 361 atgcggggca agcccacaac gaactacctt ggtgaaatcg agctactgac ccgcggaaag 421 ttcgcccaca acgcgccggt gctctacaag atccgtttcc ccaagcacca cttcccaccc 481 aaactgctcc tcctgtcggc caacaaccat gtgatctgct ttggatccgg cgagcacagc 541 atcttcatga cccaaatcca gttggagcac atcaggaaat tggcctttat tccggataag 601 atcagctccc tactgttgga tcctcacgag cagggggagg gggaggaggc agacacgaag 661 gcggaagagg aggcgaagaa gacgcacatc cagttcaaga aaaaaccctt tgttcaggcg 721 cttaaggata tttgcggacg catcgacagg gatctcgact ttcggctgtc ccaaaaaagg 781 gatcaggaag gggaacagga acaggaatcg gaacctatcc ttggctcaga agccataaca 841 tcgccggtgt ttgttgaaga caacgacgga gaggatgctc atggcttgga gcactttgta 901 gacgaaacgg aagaggaaga aaacgaatcg ctggatgata gtgcgagcct gccgtcgatc 961 accaggggat cctggccctg gctggcggcc atctatgtga acaacctgac ctccttggac 1021 ttccagtgcg gcggaaccct cgtctcgggg cgcgtggtca tcagctcggc gcactgcttc 1081 aagttgttca acaagcgctt cacatccaac gaggtcctcg tcttcttggg ccggcataat 1141 ctcaagaact ggaacgagga gggctcattg gcggcccccg tggacggcat ttacatccat 1201 cccgacttca acagtcagct gagcagctac gatgcggata tcgccgtgat catgctcaag 1261 gacgaagttc gattcaacac cttcattcgc cccgcttgcc tgtggtccgg ttccagcaag 1321 gcggagtaca ttgtaggcga gcagggcatc gtcattggct ggagctttga cagagcgaac 1381 aggacgcagg atcagaagct gtcgccggtg gctctggggg gtaagaaatc cagcgattcg 1441 cacagtgccc ccaaggtggt gaaggctccg gttgtcggga atgccgagtg ctttcgggct 1501 aatgcccact ttcgcagcct ctcctccaac cgaacttttt gcgccggcat ccacacggag 1561 gagcgggatc gccatcagca gatcagtgcc agcatttaca caggcatttc gggagccggg 1621 ctttttatcc ggcgtaacaa tcgctggatg ctgcgcggca cagtgtcagc tgccctgccc 1681 gccgttgaat cgccagaacc gggttacgtt tgctgtagaa gccagtacat tatatatgct 1741 gacgtggcca agttcctcga ttggatcacg gccttcgtaa tttaa