Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii gastrulation-defective (gd),


LOCUS       XM_017159974            1785 bp    mRNA    linear   INV 09-DEC-2024
            transcript variant X1, mRNA.
ACCESSION   XM_017159974
VERSION     XM_017159974.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017159974.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1785
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1785
                     /gene="gd"
                     /note="gastrulation-defective; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 4
                     Proteins"
                     /db_xref="GeneID:108069739"
     CDS             157..1785
                     /gene="gd"
                     /codon_start=1
                     /product="serine protease gd"
                     /protein_id="XP_017015463.1"
                     /db_xref="GeneID:108069739"
                     /translation="MRLPLTALCICILILCIELVSKAVAQGMPVSPCPKIFQYRFDGS
                     EWFGLMAVRSPDGHQPLHIRVTLSMRGKPTTNYLGEIELLTRGKFAHNAPVLYKIRFP
                     KHHFPPKLLLLSANNHVICFGSGEHSIFMTQIQLEHIRKLAFIPDKISSLLLDPHEQG
                     EGEEADTKAEEEAKKTHIQFKKKPFVQALKDICGRIDRDLDFRLSQKRDQEGEQEQES
                     EPILGSEAITSPVFVEDNDGEDAHGLEHFVDETEEEENESLDDSASLPSITRGSWPWL
                     AAIYVNNLTSLDFQCGGTLVSGRVVISSAHCFKLFNKRFTSNEVLVFLGRHNLKNWNE
                     EGSLAAPVDGIYIHPDFNSQLSSYDADIAVIMLKDEVRFNTFIRPACLWSGSSKAEYI
                     VGEQGIVIGWSFDRANRTQDQKLSPVALGGKKSSDSHSAPKVVKAPVVGNAECFRANA
                     HFRSLSSNRTFCAGIHTEERDRHQQISASIYTGISGAGLFIRRNNRWMLRGTVSAALP
                     AVESPEPGYVCCRSQYIIYADVAKFLDWITAFVI"
     misc_feature    247..531
                     /gene="gd"
                     /note="Serine protease gd N-terminus; Region: GD_N;
                     pfam16030"
                     /db_xref="CDD:464985"
     misc_feature    958..1767
                     /gene="gd"
                     /note="Trypsin-like serine protease; Many of these are
                     synthesized as inactive precursor zymogens that are
                     cleaved during limited proteolysis to generate their
                     active forms. Alignment contains also inactive enzymes
                     that have substitutions of the catalytic triad...; Region:
                     Tryp_SPc; cd00190"
                     /db_xref="CDD:238113"
     misc_feature    order(1072..1074,1237..1239,1609..1611)
                     /gene="gd"
                     /note="active site"
                     /db_xref="CDD:238113"
     misc_feature    order(1567..1569,1666..1668,1702..1704)
                     /gene="gd"
                     /note="substrate binding sites [chemical binding]; other
                     site"
                     /db_xref="CDD:238113"
ORIGIN      
        1 tattgtttca aattcgacaa aattaccata attattactt attcgatttg tttgtttcgt
       61 tttgcatagc tgaattgcag tagtgacacc ttcagatcga gatccagctc ctgatcagac
      121 cagaaacacc ccgtcgcatc ccgtcccgac attgagatgc ggctgcccct gacggcgctc
      181 tgcatctgca ttctgatcct ctgcatcgag ctcgtgtcca aggcggtcgc ccaggggatg
      241 cccgtcagtc cgtgtcccaa gatattccag taccgcttcg acggcagcga gtggttcggc
      301 ctgatggccg tgcgcagtcc ggatggccac cagccgctcc acatccgggt gacgctctcc
      361 atgcggggca agcccacaac gaactacctt ggtgaaatcg agctactgac ccgcggaaag
      421 ttcgcccaca acgcgccggt gctctacaag atccgtttcc ccaagcacca cttcccaccc
      481 aaactgctcc tcctgtcggc caacaaccat gtgatctgct ttggatccgg cgagcacagc
      541 atcttcatga cccaaatcca gttggagcac atcaggaaat tggcctttat tccggataag
      601 atcagctccc tactgttgga tcctcacgag cagggggagg gggaggaggc agacacgaag
      661 gcggaagagg aggcgaagaa gacgcacatc cagttcaaga aaaaaccctt tgttcaggcg
      721 cttaaggata tttgcggacg catcgacagg gatctcgact ttcggctgtc ccaaaaaagg
      781 gatcaggaag gggaacagga acaggaatcg gaacctatcc ttggctcaga agccataaca
      841 tcgccggtgt ttgttgaaga caacgacgga gaggatgctc atggcttgga gcactttgta
      901 gacgaaacgg aagaggaaga aaacgaatcg ctggatgata gtgcgagcct gccgtcgatc
      961 accaggggat cctggccctg gctggcggcc atctatgtga acaacctgac ctccttggac
     1021 ttccagtgcg gcggaaccct cgtctcgggg cgcgtggtca tcagctcggc gcactgcttc
     1081 aagttgttca acaagcgctt cacatccaac gaggtcctcg tcttcttggg ccggcataat
     1141 ctcaagaact ggaacgagga gggctcattg gcggcccccg tggacggcat ttacatccat
     1201 cccgacttca acagtcagct gagcagctac gatgcggata tcgccgtgat catgctcaag
     1261 gacgaagttc gattcaacac cttcattcgc cccgcttgcc tgtggtccgg ttccagcaag
     1321 gcggagtaca ttgtaggcga gcagggcatc gtcattggct ggagctttga cagagcgaac
     1381 aggacgcagg atcagaagct gtcgccggtg gctctggggg gtaagaaatc cagcgattcg
     1441 cacagtgccc ccaaggtggt gaaggctccg gttgtcggga atgccgagtg ctttcgggct
     1501 aatgcccact ttcgcagcct ctcctccaac cgaacttttt gcgccggcat ccacacggag
     1561 gagcgggatc gccatcagca gatcagtgcc agcatttaca caggcatttc gggagccggg
     1621 ctttttatcc ggcgtaacaa tcgctggatg ctgcgcggca cagtgtcagc tgccctgccc
     1681 gccgttgaat cgccagaacc gggttacgtt tgctgtagaa gccagtacat tatatatgct
     1741 gacgtggcca agttcctcga ttggatcacg gccttcgtaa tttaa