Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017159938 982 bp mRNA linear INV 09-DEC-2024 (LOC108069727), mRNA. ACCESSION XM_017159938 VERSION XM_017159938.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017159938.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..982 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..982 /gene="LOC108069727" /note="coactosin-like protein; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:108069727" CDS 332..823 /gene="LOC108069727" /codon_start=1 /product="coactosin-like protein" /protein_id="XP_017015427.1" /db_xref="GeneID:108069727" /translation="MSDGIEVEQLVESKPRRMPLATSLEKDSIREAYEDVRSDLTDTE WAVFKFDGAQIIVHGRGQCFEEFRQQFGDSERAFGYIRIQMGDEMSKRKKFIFLTWIG QEVGVIQRAKMSTDKALIKDVLNNFAVELQAGVEAELDIELFREALNRAGGANYGTGI RDN" misc_feature 413..748 /gene="LOC108069727" /note="Coactosin-like members of the ADF homology domain family; Region: ADF_coactosin_like; cd11282" /db_xref="CDD:200438" misc_feature order(605..607,611..613,653..655,659..661,692..694, 734..736,743..745) /gene="LOC108069727" /note="putative F-actin binding interface [polypeptide binding]; other site" /db_xref="CDD:200438" polyA_site 982 /gene="LOC108069727" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 cggcaccgcc gcattcgtga gatacaactc gtggtggtcg gacgacgaag ttcagcggct 61 gctccaaaat atctgcaact gtgctggttc tgttctattc tgttcctccc ttctgagtgc 121 ctacactttt ttttgtttgt tggcgttgtg ctttcgccgt cactttgtca ctttgttact 181 ttgtcacctt gcgagcgatc ttctctccgc cggactactc cgttccctcc gagactcatc 241 cgcgatcccc agaaagatcc gagatccaag atcccagagc accagcatcc cagctgcaca 301 tcgacaccaa atccaaatcc agaacaccag catgtcggac ggcatcgagg tcgagcaatt 361 ggtggagagc aagccgagaa ggatgccatt ggccacctcc ctggagaagg actcgatccg 421 cgaggcctac gaggatgtgc gctccgatct caccgacacc gagtgggcgg tattcaagtt 481 cgacggcgcc cagatcatcg tccacggaag gggccagtgc ttcgaggagt tccgacagca 541 gttcggcgac tcggaacgcg cctttggcta catacgcatc cagatgggcg acgagatgtc 601 caagcgcaag aagttcatct tcctgacgtg gattggccag gaggtgggcg tcatccagcg 661 ggcgaagatg tccacggaca aggcgctcat caaggatgtg ctgaacaact tcgccgtgga 721 actgcaggcg ggcgtggagg ccgaactgga cattgagctc ttccgggagg cgttgaaccg 781 tgccggcggt gctaactacg gaacgggaat ccgggataac taggcggcct ccaagttact 841 ttatatatat atacattttt tttttttgca tctctcaact gcttaccaaa ctgctccttt 901 ctctttaatt attatgaatt aattttatga aatttaaaaa ctgtacattt tatgtaatat 961 tatacaagca attgtaacat ta