Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii coactosin-like protein


LOCUS       XM_017159938             982 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108069727), mRNA.
ACCESSION   XM_017159938
VERSION     XM_017159938.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017159938.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..982
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..982
                     /gene="LOC108069727"
                     /note="coactosin-like protein; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 2
                     Proteins"
                     /db_xref="GeneID:108069727"
     CDS             332..823
                     /gene="LOC108069727"
                     /codon_start=1
                     /product="coactosin-like protein"
                     /protein_id="XP_017015427.1"
                     /db_xref="GeneID:108069727"
                     /translation="MSDGIEVEQLVESKPRRMPLATSLEKDSIREAYEDVRSDLTDTE
                     WAVFKFDGAQIIVHGRGQCFEEFRQQFGDSERAFGYIRIQMGDEMSKRKKFIFLTWIG
                     QEVGVIQRAKMSTDKALIKDVLNNFAVELQAGVEAELDIELFREALNRAGGANYGTGI
                     RDN"
     misc_feature    413..748
                     /gene="LOC108069727"
                     /note="Coactosin-like members of the ADF homology domain
                     family; Region: ADF_coactosin_like; cd11282"
                     /db_xref="CDD:200438"
     misc_feature    order(605..607,611..613,653..655,659..661,692..694,
                     734..736,743..745)
                     /gene="LOC108069727"
                     /note="putative F-actin binding interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:200438"
     polyA_site      982
                     /gene="LOC108069727"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 cggcaccgcc gcattcgtga gatacaactc gtggtggtcg gacgacgaag ttcagcggct
       61 gctccaaaat atctgcaact gtgctggttc tgttctattc tgttcctccc ttctgagtgc
      121 ctacactttt ttttgtttgt tggcgttgtg ctttcgccgt cactttgtca ctttgttact
      181 ttgtcacctt gcgagcgatc ttctctccgc cggactactc cgttccctcc gagactcatc
      241 cgcgatcccc agaaagatcc gagatccaag atcccagagc accagcatcc cagctgcaca
      301 tcgacaccaa atccaaatcc agaacaccag catgtcggac ggcatcgagg tcgagcaatt
      361 ggtggagagc aagccgagaa ggatgccatt ggccacctcc ctggagaagg actcgatccg
      421 cgaggcctac gaggatgtgc gctccgatct caccgacacc gagtgggcgg tattcaagtt
      481 cgacggcgcc cagatcatcg tccacggaag gggccagtgc ttcgaggagt tccgacagca
      541 gttcggcgac tcggaacgcg cctttggcta catacgcatc cagatgggcg acgagatgtc
      601 caagcgcaag aagttcatct tcctgacgtg gattggccag gaggtgggcg tcatccagcg
      661 ggcgaagatg tccacggaca aggcgctcat caaggatgtg ctgaacaact tcgccgtgga
      721 actgcaggcg ggcgtggagg ccgaactgga cattgagctc ttccgggagg cgttgaaccg
      781 tgccggcggt gctaactacg gaacgggaat ccgggataac taggcggcct ccaagttact
      841 ttatatatat atacattttt tttttttgca tctctcaact gcttaccaaa ctgctccttt
      901 ctctttaatt attatgaatt aattttatga aatttaaaaa ctgtacattt tatgtaatat
      961 tatacaagca attgtaacat ta