PREDICTED: Drosophila takahashii cofilin/actin-depolymerizing

LOCUS       XM_017159929             664 bp    mRNA    linear   INV 09-DEC-2024
            factor homolog (LOC108069720), mRNA.
ACCESSION   XM_017159929
VERSION     XM_017159929.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017159929.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..664
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..664
                     /gene="LOC108069720"
                     /note="cofilin/actin-depolymerizing factor homolog;
                     Derived by automated computational analysis using gene
                     prediction method: Gnomon. Supporting evidence includes
                     similarity to: 1 Protein"
                     /db_xref="GeneID:108069720"
     CDS             152..598
                     /gene="LOC108069720"
                     /codon_start=1
                     /product="cofilin/actin-depolymerizing factor homolog"
                     /protein_id="XP_017015418.2"
                     /db_xref="GeneID:108069720"
                     /translation="MASGIELSRECRQVFEQIRKLKQHRYAVFVIQDELEIKVEYLGV
                     REATYDDFLADLRRSGANQCRFAVYDYAYQHQCQGTSSTCLKEKLFLMLWCPTLAKVK
                     DKMLYSSTFAVLKREFAGVQKCIQATELDEACRNAVEEQLRSLDRE"
     misc_feature    158..577
                     /gene="LOC108069720"
                     /note="Cofilin, Destrin, and related actin depolymerizing
                     factors; Region: ADF_cofilin_like; cd11286"
                     /db_xref="CDD:200442"
     misc_feature    158..163
                     /gene="LOC108069720"
                     /note="putative G-actin interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:200442"
     misc_feature    order(407..409,413..415,455..457,536..538,545..547)
                     /gene="LOC108069720"
                     /note="putative F-actin interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:200442"
     polyA_site      664
                     /gene="LOC108069720"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 gtgcccaggg cttttggcaa gtttccgcct ttcggtttcg aacaaatcta aattccaaat
       61 tttccagcct ggctgagata tgctctttgc tctacccact ggcggccaac tgttgacgta
      121 actgctccac tgctaaccct aaagaaaaag aatggcatct ggaatcgagc tgagccgcga
      181 gtgccggcag gtcttcgagc agattcgcaa gctgaagcag catcgctacg cggtgttcgt
      241 catccaggac gagctggaga tcaaggtgga gtatctggga gtgcgggagg cgacctacga
      301 tgacttcctc gcggatctgc gacgttcggg ggcgaatcag tgccgctttg ccgtctacga
      361 ttatgcgtat cagcatcagt gccagggcac ctcgtccacc tgcctgaagg agaagctctt
      421 cctgatgctc tggtgcccca cgctggccaa ggtcaaggac aagatgctct attcgagcac
      481 ctttgcggtg ctgaagcggg agttcgcggg cgtccagaag tgcatccagg ccaccgaact
      541 ggacgaggcc tgtcgcaatg ccgtcgagga gcagctgcgc tcgctggaca gggaatagat
      601 gtccttctgg tttaccccat acttatcatc cgcctccttg aaatacagta aggcccattt
      661 aaaa