PREDICTED: Drosophila takahashii N(G),N(G)-dimethylarginine

LOCUS       XM_017159715            1327 bp    mRNA    linear   INV 09-DEC-2024
            dimethylaminohydrolase 1 (LOC108069584), mRNA.
ACCESSION   XM_017159715
VERSION     XM_017159715.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017159715.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1327
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1327
                     /gene="LOC108069584"
                     /note="N(G),N(G)-dimethylarginine dimethylaminohydrolase
                     1; Derived by automated computational analysis using gene
                     prediction method: Gnomon. Supporting evidence includes
                     similarity to: 2 Proteins"
                     /db_xref="GeneID:108069584"
     CDS             110..916
                     /gene="LOC108069584"
                     /codon_start=1
                     /product="N(G),N(G)-dimethylarginine
                     dimethylaminohydrolase 1"
                     /protein_id="XP_017015204.2"
                     /db_xref="GeneID:108069584"
                     /translation="MSPKYTHAIVARISDALLENGEFDVQLAKQQHEQYCTLLRSIGL
                     DVIELPPDDQLPEGVFVENSAVICNGVALIGRSEHAKRRREAESMAIILKKELDIPVI
                     EIEDPHAQLDGGDVLFTGREFFIGISGFTNEEGARAVAMAFPEYPVTPIRVNGAKRLK
                     YYVTMAGPDVLAVSSSVTCQDIVKRMERVGSFTYQKLTLPEESAANMLYINGTIVHRS
                     PTEIPEAYKTLKEKIDIPTRNINISEFSQYSSGLTSSCLLLRRWKSIRSL"
     misc_feature    164..>730
                     /gene="LOC108069584"
                     /note="N-Dimethylarginine dimethylaminohydrolase [Amino
                     acid transport and metabolism]; Region: DdaH; COG1834"
                     /db_xref="CDD:441439"
     polyA_site      1327
                     /gene="LOC108069584"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ttggcgttcg ccatacggtc atactgtggc ccatctccaa ttgatatccg catcttcgca
       61 tccgcatccg catctgcatc ccgccgagga agtggccaat ccgcccacca tgtcgcccaa
      121 atacacacat gcgattgtgg ccagaatctc ggatgccctg ctggagaacg gggagttcga
      181 cgtgcagctg gcgaagcagc agcacgagca gtactgcacc ctcctgagga gcattggcct
      241 ggacgtgatc gaactgccgc cggatgacca gctgcccgag ggcgtcttcg tggagaacag
      301 cgcggtgatc tgcaatggag tggccctgat tggcagatcg gagcatgcca agcggcgacg
      361 cgaggccgag agcatggcca ttatactcaa aaaggagcta gacattccgg tcatcgagat
      421 tgaggatccg catgcgcaac tcgatggcgg agatgtgctt tttacgggac gcgaattctt
      481 tattggaatc tctggcttta ccaacgagga gggcgccagg gcggtggcca tggcctttcc
      541 cgagtatcca gtgacgccga ttcgggtaaa cggtgccaag aggctgaagt actacgtgac
      601 catggcggga ccggatgtgc tggccgtcag cagcagcgtc acctgccagg acatcgtgaa
      661 gcggatggag cgggtgggca gcttcaccta ccagaagctg actttgcccg aggagagcgc
      721 ggccaatatg ctgtacatca acggaacgat tgtgcacaga tcgccgacgg agattccaga
      781 agcctacaag actttaaaag agaaaatcga cattccaaca cgcaacataa acattagcga
      841 atttagccaa tattccagcg gactgacctc gtcgtgtttg ctgctgcgac gctggaagtc
      901 catccggagt ctgtgaatct ccgggagccg cagagtgaga agcattgcca tgagaaacat
      961 gcacaacggg cccagggagt cggatctttg gggcatcagc aatatcgtat tatcttatta
     1021 tagtttacac acatctcttg ttattgttac aacttaagat taaaccttta aacgctaatc
     1081 aaactgatga taatcggcat tcctcaccca aactccatga caatgttgaa tgaatatcat
     1141 tattgtatct actttacaag tagcttaaat gccacatttg taatctcttg acgaaacctt
     1201 aaatctaata tctaaaaagc ctctaaatgt tttagttatt gtttgaaaca acatgttata
     1261 gatcaaacgc cagttatttt aagtgaacat ttcatttatt tatatctaaa tataaactta
     1321 gcctaca