Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii ubiquinone biosynthesis protein


LOCUS       XM_017159700            1063 bp    mRNA    linear   INV 09-DEC-2024
            COQ3, mitochondrial (Coq5), mRNA.
ACCESSION   XM_017159700
VERSION     XM_017159700.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017159700.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1063
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1063
                     /gene="Coq5"
                     /note="ubiquinone biosynthesis protein COQ3,
                     mitochondrial; Derived by automated computational analysis
                     using gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 3 Proteins"
                     /db_xref="GeneID:108069574"
     CDS             60..977
                     /gene="Coq5"
                     /codon_start=1
                     /product="2-methoxy-6-polyprenyl-1,4-benzoquinol
                     methylase, mitochondrial"
                     /protein_id="XP_017015189.2"
                     /db_xref="GeneID:108069574"
                     /translation="MQSTRSTRLLSLARRIVHSRTAAQSARESTGSGAERPRGAESTS
                     GSEQTTHFGFQTVRESEKEQKVHEVFEQVANSYDMMNDAMSLGIHRVWKDVFVERLGP
                     THGMRLLDMAGGTGDISFRYLRYLANQPNPQQRGSHVTVSDINQHMLDVGEERARRLG
                     LTTDRLANCTVAWQCADAEKLPFRDESFSAYTIAFGIRNCTHVDKVLAEAYRVLQPGG
                     RFMCLEFSHLTNETMQWLYDQYSFQVIPPMGQLLAGQWQAYQYLVESIRRFPKQEQFK
                     RMIEQAGFEQVSYENLTFGVVSIHSGFKL"
     misc_feature    219..974
                     /gene="Coq5"
                     /note="bifunctional demethylmenaquinone
                     methyltransferase/2-methoxy-6-polyprenyl-1,4-benzoquinol
                     methylase UbiE; Region: ubiE; PRK00216"
                     /db_xref="CDD:234689"
     misc_feature    order(390..410,486..491,585..593,636..638)
                     /gene="Coq5"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     polyA_site      1063
                     /gene="Coq5"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 gtgtttgtta tttcataata taatatagtc ctaaggaaga accgacttaa atcgccgaaa
       61 tgcagagcac gaggagtacc cgcctgctgt ccctggccag gaggatcgtc cacagccgga
      121 cggcggcgca gtcggcccgg gagtccacag gatccggagc ggagaggccg agaggtgcgg
      181 aatccacttc cggatcggag caaaccacgc atttcggctt ccagacggtc agggaaagcg
      241 agaaggagca aaaggttcac gaggtcttcg agcaggtggc caactcctac gacatgatga
      301 acgacgccat gtccctgggc atccatcgcg tgtggaagga cgtgttcgtg gagcgactgg
      361 gccccacgca cggcatgcgc ctcctggaca tggccggcgg cacgggcgac atcagcttcc
      421 gttacctgcg ctacctggcc aaccagccga atccccagca gcgcggcagc catgtcaccg
      481 tgtcggacat caaccagcac atgctggacg tgggcgagga gcgggccagg cgcctgggcc
      541 tgaccaccga ccggctggcc aactgcaccg tcgcctggca gtgcgccgat gccgagaagc
      601 tgcccttccg ggacgagagc ttcagcgcct acacgattgc ctttggcatc cggaactgca
      661 cgcatgtgga caaggtcctt gccgaggcgt atagagtgct gcagcctggc ggacgcttca
      721 tgtgcctgga gttcagccac ctgaccaacg agacgatgca gtggctctac gatcagtact
      781 ccttccaggt gatcccgccc atgggccaac tgctggccgg ccagtggcag gcgtaccagt
      841 acctggtgga gagcatccgg cggttcccca agcaggagca gttcaagcgg atgatcgagc
      901 aggcgggatt cgagcaggtg tcctacgaga acctcacctt cggcgtcgtc agcattcact
      961 ccggcttcaa gctgtgagcc cttaggatta ggaaacacct ctgtgcgcgc gtttcaccat
     1021 gccgctcacg tcgctcgggt cataaagcat cgaattgaac aag