Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017159700 1063 bp mRNA linear INV 09-DEC-2024 COQ3, mitochondrial (Coq5), mRNA. ACCESSION XM_017159700 VERSION XM_017159700.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017159700.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1063 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1063 /gene="Coq5" /note="ubiquinone biosynthesis protein COQ3, mitochondrial; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins" /db_xref="GeneID:108069574" CDS 60..977 /gene="Coq5" /codon_start=1 /product="2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial" /protein_id="XP_017015189.2" /db_xref="GeneID:108069574" /translation="MQSTRSTRLLSLARRIVHSRTAAQSARESTGSGAERPRGAESTS GSEQTTHFGFQTVRESEKEQKVHEVFEQVANSYDMMNDAMSLGIHRVWKDVFVERLGP THGMRLLDMAGGTGDISFRYLRYLANQPNPQQRGSHVTVSDINQHMLDVGEERARRLG LTTDRLANCTVAWQCADAEKLPFRDESFSAYTIAFGIRNCTHVDKVLAEAYRVLQPGG RFMCLEFSHLTNETMQWLYDQYSFQVIPPMGQLLAGQWQAYQYLVESIRRFPKQEQFK RMIEQAGFEQVSYENLTFGVVSIHSGFKL" misc_feature 219..974 /gene="Coq5" /note="bifunctional demethylmenaquinone methyltransferase/2-methoxy-6-polyprenyl-1,4-benzoquinol methylase UbiE; Region: ubiE; PRK00216" /db_xref="CDD:234689" misc_feature order(390..410,486..491,585..593,636..638) /gene="Coq5" /note="S-adenosylmethionine binding site [chemical binding]; other site" /db_xref="CDD:100107" polyA_site 1063 /gene="Coq5" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 gtgtttgtta tttcataata taatatagtc ctaaggaaga accgacttaa atcgccgaaa 61 tgcagagcac gaggagtacc cgcctgctgt ccctggccag gaggatcgtc cacagccgga 121 cggcggcgca gtcggcccgg gagtccacag gatccggagc ggagaggccg agaggtgcgg 181 aatccacttc cggatcggag caaaccacgc atttcggctt ccagacggtc agggaaagcg 241 agaaggagca aaaggttcac gaggtcttcg agcaggtggc caactcctac gacatgatga 301 acgacgccat gtccctgggc atccatcgcg tgtggaagga cgtgttcgtg gagcgactgg 361 gccccacgca cggcatgcgc ctcctggaca tggccggcgg cacgggcgac atcagcttcc 421 gttacctgcg ctacctggcc aaccagccga atccccagca gcgcggcagc catgtcaccg 481 tgtcggacat caaccagcac atgctggacg tgggcgagga gcgggccagg cgcctgggcc 541 tgaccaccga ccggctggcc aactgcaccg tcgcctggca gtgcgccgat gccgagaagc 601 tgcccttccg ggacgagagc ttcagcgcct acacgattgc ctttggcatc cggaactgca 661 cgcatgtgga caaggtcctt gccgaggcgt atagagtgct gcagcctggc ggacgcttca 721 tgtgcctgga gttcagccac ctgaccaacg agacgatgca gtggctctac gatcagtact 781 ccttccaggt gatcccgccc atgggccaac tgctggccgg ccagtggcag gcgtaccagt 841 acctggtgga gagcatccgg cggttcccca agcaggagca gttcaagcgg atgatcgagc 901 aggcgggatt cgagcaggtg tcctacgaga acctcacctt cggcgtcgtc agcattcact 961 ccggcttcaa gctgtgagcc cttaggatta ggaaacacct ctgtgcgcgc gtttcaccat 1021 gccgctcacg tcgctcgggt cataaagcat cgaattgaac aag