Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017158338 748 bp mRNA linear INV 09-DEC-2024 homolog MagR (MagR), transcript variant X2, mRNA. ACCESSION XM_017158338 VERSION XM_017158338.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017158338.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..748 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..748 /gene="MagR" /note="Iron-sulfur cluster assembly 1 homolog MagR; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 7 Proteins" /db_xref="GeneID:108068646" CDS 100..492 /gene="MagR" /codon_start=1 /product="iron-sulfur cluster assembly 1 homolog, mitochondrial isoform X2" /protein_id="XP_017013827.1" /db_xref="GeneID:108068646" /translation="MATRVVATATVRAVKGRKLIPTRAALTLTPAAVLRIKTLLQDKP DMVGLKVGVRQRGCNGLSYTLDYASQKDKLDEEVIQDGVKVFIDKKAQLSLLGTEMDF VESKLSSEFVFNNPNIKGTCGCGESFSM" misc_feature 178..486 /gene="MagR" /note="Iron-sulfur cluster assembly accessory protein; Region: TIGR00049" /db_xref="CDD:272875" polyA_site 748 /gene="MagR" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 acagtagtgt catcaccgtc tggtaataga actattgtat tttcgaattt ttttgtggaa 61 attgtcgagg aaaacaaatt atataaagct cgcgaagcga tggcaacacg tgtggtggca 121 acggcgacgg tgcgggcggt caagggtcgc aagctgatcc cgacgcgggc cgctctgacg 181 ttgactccag cggcggtgct gcgcatcaag accctgctgc aggacaaacc ggacatggtt 241 ggcttgaagg tgggtgtgcg ccagcgggga tgcaatggac tctcctacac actggactat 301 gccagtcaaa aagacaagtt ggacgaggag gtgatccagg atggcgtcaa ggtgttcatc 361 gacaagaagg cgcagctatc gctgttgggc accgagatgg actttgtgga atcgaagctg 421 tccagcgagt tcgtgttcaa caatccgaac atcaagggca cctgcggctg cggcgaatcg 481 ttcagcatgt aaaccgatgg agatccggag gagatccgcc ggcacccgcc tcgcagacct 541 aaattaacca agtttaaatg cagtacgcgg cctaagctag tatctcattt tttctttctt 601 tgtaaatttc acttcgcaaa cgaattctaa atgttaagtt gtgttctata gttaaatttt 661 agttgtagcg ctaggtaagt gacccacccg cttctagccc tagttcaaaa tatagacaag 721 gaatgttcta caaaagatta cccttcga