Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii Iron-sulfur cluster assembly 1


LOCUS       XM_017158338             748 bp    mRNA    linear   INV 09-DEC-2024
            homolog MagR (MagR), transcript variant X2, mRNA.
ACCESSION   XM_017158338
VERSION     XM_017158338.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017158338.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..748
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..748
                     /gene="MagR"
                     /note="Iron-sulfur cluster assembly 1 homolog MagR;
                     Derived by automated computational analysis using gene
                     prediction method: Gnomon. Supporting evidence includes
                     similarity to: 7 Proteins"
                     /db_xref="GeneID:108068646"
     CDS             100..492
                     /gene="MagR"
                     /codon_start=1
                     /product="iron-sulfur cluster assembly 1 homolog,
                     mitochondrial isoform X2"
                     /protein_id="XP_017013827.1"
                     /db_xref="GeneID:108068646"
                     /translation="MATRVVATATVRAVKGRKLIPTRAALTLTPAAVLRIKTLLQDKP
                     DMVGLKVGVRQRGCNGLSYTLDYASQKDKLDEEVIQDGVKVFIDKKAQLSLLGTEMDF
                     VESKLSSEFVFNNPNIKGTCGCGESFSM"
     misc_feature    178..486
                     /gene="MagR"
                     /note="Iron-sulfur cluster assembly accessory protein;
                     Region: TIGR00049"
                     /db_xref="CDD:272875"
     polyA_site      748
                     /gene="MagR"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 acagtagtgt catcaccgtc tggtaataga actattgtat tttcgaattt ttttgtggaa
       61 attgtcgagg aaaacaaatt atataaagct cgcgaagcga tggcaacacg tgtggtggca
      121 acggcgacgg tgcgggcggt caagggtcgc aagctgatcc cgacgcgggc cgctctgacg
      181 ttgactccag cggcggtgct gcgcatcaag accctgctgc aggacaaacc ggacatggtt
      241 ggcttgaagg tgggtgtgcg ccagcgggga tgcaatggac tctcctacac actggactat
      301 gccagtcaaa aagacaagtt ggacgaggag gtgatccagg atggcgtcaa ggtgttcatc
      361 gacaagaagg cgcagctatc gctgttgggc accgagatgg actttgtgga atcgaagctg
      421 tccagcgagt tcgtgttcaa caatccgaac atcaagggca cctgcggctg cggcgaatcg
      481 ttcagcatgt aaaccgatgg agatccggag gagatccgcc ggcacccgcc tcgcagacct
      541 aaattaacca agtttaaatg cagtacgcgg cctaagctag tatctcattt tttctttctt
      601 tgtaaatttc acttcgcaaa cgaattctaa atgttaagtt gtgttctata gttaaatttt
      661 agttgtagcg ctaggtaagt gacccacccg cttctagccc tagttcaaaa tatagacaag
      721 gaatgttcta caaaagatta cccttcga