Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii Iron-sulfur cluster assembly 1


LOCUS       XM_017158337             751 bp    mRNA    linear   INV 09-DEC-2024
            homolog MagR (MagR), transcript variant X1, mRNA.
ACCESSION   XM_017158337
VERSION     XM_017158337.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017158337.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..751
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..751
                     /gene="MagR"
                     /note="Iron-sulfur cluster assembly 1 homolog MagR;
                     Derived by automated computational analysis using gene
                     prediction method: Gnomon. Supporting evidence includes
                     similarity to: 1 Protein"
                     /db_xref="GeneID:108068646"
     CDS             100..495
                     /gene="MagR"
                     /codon_start=1
                     /product="iron-sulfur cluster assembly 1 homolog,
                     mitochondrial isoform X1"
                     /protein_id="XP_017013826.1"
                     /db_xref="GeneID:108068646"
                     /translation="MATRVVATATVRAVKGRKLIPTRAALTLTPAAVLRIKTLLQDKP
                     DMVGLKVGVRQRGCNGLSYTLDYASQKADKLDEEVIQDGVKVFIDKKAQLSLLGTEMD
                     FVESKLSSEFVFNNPNIKGTCGCGESFSM"
     misc_feature    172..492
                     /gene="MagR"
                     /note="Fe-S cluster assembly iron-binding protein IscA
                     [Posttranslational modification, protein turnover,
                     chaperones]; Region: IscA; COG0316"
                     /db_xref="CDD:440085"
     polyA_site      751
                     /gene="MagR"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 acagtagtgt catcaccgtc tggtaataga actattgtat tttcgaattt ttttgtggaa
       61 attgtcgagg aaaacaaatt atataaagct cgcgaagcga tggcaacacg tgtggtggca
      121 acggcgacgg tgcgggcggt caagggtcgc aagctgatcc cgacgcgggc cgctctgacg
      181 ttgactccag cggcggtgct gcgcatcaag accctgctgc aggacaaacc ggacatggtt
      241 ggcttgaagg tgggtgtgcg ccagcgggga tgcaatggac tctcctacac actggactat
      301 gccagtcaaa aagcagacaa gttggacgag gaggtgatcc aggatggcgt caaggtgttc
      361 atcgacaaga aggcgcagct atcgctgttg ggcaccgaga tggactttgt ggaatcgaag
      421 ctgtccagcg agttcgtgtt caacaatccg aacatcaagg gcacctgcgg ctgcggcgaa
      481 tcgttcagca tgtaaaccga tggagatccg gaggagatcc gccggcaccc gcctcgcaga
      541 cctaaattaa ccaagtttaa atgcagtacg cggcctaagc tagtatctca ttttttcttt
      601 ctttgtaaat ttcacttcgc aaacgaattc taaatgttaa gttgtgttct atagttaaat
      661 tttagttgta gcgctaggta agtgacccac ccgcttctag ccctagttca aaatatagac
      721 aaggaatgtt ctacaaaaga ttacccttcg a